Top
RASA1
Localization (UniProt annotation) Cytoplasm Function (UniProt annotation) Inhibitory regulator of the Ras-cyclic AMP pathwayStimulates the GTPase of normal but not oncogenic Ras p21; thisstimulation may be further increased in the presence of NCK1 Catalytic Activity (UniProt annotation) N/A Protein Sequence MMAAEAGSEEGGPVTAGAGGGGAAAGSSAYPAVCRVKIPAALPVAAAPYPGLVETGVAGTLGGGAALGSEFLGAGSVAGA
LGGAGLTGGGTAAGVAGAAAGVAGAAVAGPSGDMALTKLPTSLLAETLGPGGGFPPLPPPPYLPPLGAGLGTVDEGDSLD
GPEYEEEEVAIPLTAPPTNQWYHGKLDRTIAEERLRQAGKSGSYLIRESDRRPGSFVLSFLSQMNVVNHFRIIAMCGDYY
IGGRRFSSLSDLIGYYSHVSCLLKGEKLLYPVAPPEPVEDRRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWV
TNLRTDEQGLIVEDLVEEVGREEDPHEGKIWFHGKISKQEAYNLLMTVGQVCSFLVRPSDNTPGDYSLYFRTNENIQRFK
ICPTPNNQFMMGGRYYNSIGDIIDHYRKEQIVEGYYLKEPVPMQDQEQVLNDTVDGKEIYNTIRRKTKDAFYKNIVKKGY
LLKKGKGKRWKNLYFILEGSDAQLIYFESEKRATKPKGLIDLSVCSVYVVHDSLFGRPNCFQIVVQHFSEEHYIFYFAGE
TPEQAEDWMKGLQAFCNLRKSSPGTSNKRLRQVSSLVLHIEEAHKLPVKHFTNPYCNIYLNSVQVAKTHAREGQNPVWSE
EFVFDDLPPDINRFEITLSNKTKKSKDPDILFMRCQLSRLQKGHATDEWFLLSSHIPLKGIEPGSLRVRARYSMEKIMPE
EEYSEFKELILQKELHVVYALSHVCGQDRTLLASILLRIFLHEKLESLLLCTLNDREISMEDEATTLFRATTLASTLMEQ
YMKATATQFVHHALKDSILKIMESKQSCELSPSKLEKNEDVNTNLTHLLNILSELVEKIFMASEILPPTLRYIYGCLQKS
VQHKWPTNTTMRTRVVSGFVFLRLICPAILNPRMFNIISDSPSPIAARTLILVAKSVQNLANLVEFGAKEPYMEGVNPFI
KSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLLAITELLQQKQNQY
TKTNDVR
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
Pathway ID Pathway Name Pathway Description (KEGG) hsa04010 MAPK signaling pathway The mitogen-activated protein kinase (MAPK) cascade is a highly conserved module that is involved in various cellular functions, including cell proliferation, differentiation and migration. Mammals express at least four distinctly regulated groups of MAPKs, extracellular signal-related kinases (ERK)-1/2, Jun amino-terminal kinases (JNK1/2/3), p38 proteins (p38alpha/beta/gamma/delta) and ERK5, that are activated by specific MAPKKs: MEK1/2 for ERK1/2, MKK3/6 for the p38, MKK4/7 (JNKK1/2) for the JNKs, and MEK5 for ERK5. Each MAPKK, however, can be activated by more than one MAPKKK, increasing the complexity and diversity of MAPK signalling. Presumably each MAPKKK confers responsiveness to distinct stimuli. For example, activation of ERK1/2 by growth factors depends on the MAPKKK c-Raf, but other MAPKKKs may activate ERK1/2 in response to pro-inflammatory stimuli. hsa04014 Ras signaling pathway The Ras proteins are GTPases that function as molecular switches for signaling pathways regulating cell proliferation, survival, growth, migration, differentiation or cytoskeletal dynamism. Ras proteins transduce signals from extracellular growth factors by cycling between inactive GDP-bound and active GTP-bound states. The exchange of GTP for GDP on RAS is regulated by guanine nucleotide exchange factors (GEFs) and GTPase-activating proteins (GAPs). Activated RAS (RAS-GTP) regulates multiple cellular functions through effectors including Raf, phosphatidylinositol 3-kinase (PI3K) and Ral guanine nucleotide-dissociation stimulator (RALGDS). hsa04360 Axon guidance Axon guidance represents a key stage in the formation of neuronal network. Axons are guided by a variety of guidance factors, such as netrins, ephrins, Slits, and semaphorins. These guidance cues are read by growth cone receptors, and signal transduction pathways downstream of these receptors converge onto the Rho GTPases to elicit changes in cytoskeletal organization that determine which way the growth cone will turn.
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-186763 Downstream signal transduction. The role of autophosphorylation sites on PDGF receptors are to provide docking sites for downstream signal transduction molecules which contain SH2 domains. The SH2 domain is a conserved motif of around 100 amino acids that can bind a phosphorylated tyrosine residue. These downstream molecules are activated upon binding to, or phosphorylated by, the receptor kinases intrinsic to PDGF receptors.Some of the dowstream molecules are themselves enzymes, such as phosphatidylinositol 3'-kinase (PI3K), phospholipase C (PLC-gamma), the Src family of tyrosine kinases, the tyrosine phosphatase SHP2, and a GTPase activating protein (GAP) for Ras. Others such as Grb2 are adaptor molecules which link the receptor with downstream catalytic molecules R-HSA-3928662 EPHB-mediated forward signaling. Multiple EPHB receptors contribute directly to dendritic spine development and morphogenesis. These are more broadly involved in post-synaptic development through activation of focal adhesion kinase (FAK) and Rho family GTPases and their GEFs. Dendritic spine morphogenesis is a vital part of the process of synapse formation and maturation during CNS development. Dendritic spine morphogenesis is characterized by filopodia shortening followed by the formation of mature mushroom-shaped spines (Moeller et al. 2006). EPHBs control neuronal morphology and motility by modulation of the actin cytoskeleton. EPHBs control dendritic filopodia motility, enabling synapse formation. EPHBs exert these effects through interacting with the guanine exchange factors (GEFs) such as intersectin and kalirin. The intersectin-CDC42-WASP-actin and kalirin-RAC-PAK-actin pathways have been proposed to regulate the EPHB receptor mediated morphogenesis and maturation of dendritic spines in cultured hippocampal and cortical neurons (Irie & Yamaguchi 2002, Penzes et al. 2003). EPHBs are also involved in the regulation of dendritic spine morphology through FAK which activates the RHOA-ROCK-LIMK-1 pathway to suppress cofilin activity and inhibit cofilin-mediated dendritic spine remodeling (Shi et al. 2009) R-HSA-5218921 VEGFR2 mediated cell proliferation. VEGFR2 stimulates ERK not via GRB2-SOS-RAS, but via pY1175-dependent phosphorylation of PLC gamma and subsequent activation of PKCs. PKC plays an important mediatory role in the proliferative Ras/Raf/MEK/ERK pathway. PKC alpha can intersect the Ras/Raf/MEK/ERK cascade at the level of Ras (Clark et al. 2004) or downstream of Ras through direct phosphorylation of Raf (Kolch et al. 1993). VEGF stimulation leads to Ras activation in a Ras-guanine nucleotide exchange factor (GEF) independent mechanism. It rather relies on modulating the regulation of Ras-GTPase activating protein (GAP) than regulation of Ras-GEFS (Wu et al. 2003) R-HSA-5658442 Regulation of RAS by GAPs. The intrinsic GTPase activity of RAS proteins is stimulated by the GAP proteins, of which there are at least 10 in the human genome (reviewed in King et al, 2013) R-HSA-6802949 Signaling by RAS mutants. Members of the RAS gene family were the first oncogenes to be identified, and mutations in RAS are present in ~20-30% of human cancers (reviewed in Prior et al, 2012). Mutations in the KRAS gene are the most prevalent, and are found with high frequency in colorectal cancer, non-small cell lung cancer and pancreatic cancer, among others. The reasons for the lower prevalence of HRAS and NRAS mutations in human cancers are not fully understood, but may reflect gene-specific functions as well as differential codon usage and spatio-temporal regulation (reviewed in Prior et al, 2012; Stephen et al, 2014; Pylayeva-Gupta et al, 2011). Activating RAS mutations contribute to cellular proliferation, transformation and survival by activating the MAPK signaling pathway, the AKT pathway and the RAL GDS pathway, among others (reviewed in Stephen et al, 2014; Pylayeva-Gupta et al, 2011).Although the frequency and distribution varies between RAS genes and cancer types, the vast majority of activating RAS mutations occur at one of three residues - G12, G13 and Q61. Mutations at these sites favour the RAS:GTP bound form and yield constitutively active versions of the protein (reviewed in Prior et al, 2012) R-HSA-8849471 PTK6 Regulates RHO GTPases, RAS GTPase and MAP kinases. PTK6 promotes cell motility and migration by regulating the activity of RHO GTPases RAC1 (Chen et al. 2004) and RHOA (Shen et al. 2008). PTK6 inhibits RAS GTPase activating protein RASA1 (Shen et al. 2008) and may be involved in MAPK7 (ERK5) activation (Ostrander et al. 2007, Zheng et al
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ANXA6 Far Western, Reconstituted Complex physical 10571081 , (Europe PMC )NA BioGRID APP Reconstituted Complex physical 21832049 , (Europe PMC )NA BioGRID ARHGAP35 Affinity Capture-Western, Reconstituted Complex physical 8189062 , 8419471 , 9034330 , (Europe PMC )NA BioGRID BBS10 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT BTRC Phenotypic Suppression genetic 12151397 , (Europe PMC )NA BioGRID CAV2 Affinity Capture-Western, Reconstituted Complex physical 12091389 , (Europe PMC )NA BioGRID CD5 Affinity Capture-Western, pull down association, physical 9603468 , (Europe PMC )0.35 BioGRID, IntAct, MINT CSK Reconstituted Complex physical 7544435 , (Europe PMC )NA BioGRID DNAJA3 Affinity Capture-Western, Reconstituted Complex physical 11116152 , (Europe PMC )NA BioGRID DOK1 Affinity Capture-Western, Protein-peptide, Reconstituted Complex physical 10688886 , 10799545 , 10822173 , 11551902 , 15151996 , 22974441 , 9008161 , 9478921 , 9822717 , (Europe PMC )NA BioGRID DOK2 Affinity Capture-Western physical 10822173 , 9478921 , (Europe PMC )NA BioGRID EGFR Protein-peptide, Reconstituted Complex, protein array direct interaction, physical 1385407 , 16273093 , 8647858 , (Europe PMC )0.44 BioGRID, IntAct, MINT EIF1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT EPHB2 Affinity Capture-Western, Reconstituted Complex physical 10644995 , 9233798 , (Europe PMC )NA BioGRID EPHB3 Affinity Capture-Western, Reconstituted Complex physical 9674711 , (Europe PMC )NA BioGRID ERBB2 Protein-peptide, protein array, two hybrid array direct interaction, physical, physical association 16273093 , 24412244 , (Europe PMC )0.59 BioGRID, IntAct, MINT ERBB3 Protein-peptide, protein array direct interaction, physical 16273093 , (Europe PMC )0.44 BioGRID, IntAct, MINT ERBB4 Protein-peptide, protein array direct interaction, physical 16273093 , (Europe PMC )0.44 BioGRID, IntAct, MINT EZH2 Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID FGFR1 Reconstituted Complex physical 8321198 , (Europe PMC )NA BioGRID G3BP1 Affinity Capture-Western physical 9632780 , (Europe PMC )NA BioGRID GRB2 Affinity Capture-Western physical 12441060 , (Europe PMC )NA BioGRID HCK Affinity Capture-Western, Reconstituted Complex physical 7782336 , (Europe PMC )NA BioGRID HNRNPL Affinity Capture-RNA physical 28611215 , (Europe PMC )NA BioGRID HRAS Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Reconstituted Complex, x-ray crystallography direct interaction, physical 11389730 , 26721396 , 7628625 , 9219684 , (Europe PMC )0.44 BioGRID, IntAct HTT Affinity Capture-Western, Reconstituted Complex physical 9079622 , (Europe PMC )NA BioGRID IGF1R Affinity Capture-Western, Reconstituted Complex, pull down association, physical 7642582 , (Europe PMC )0.35 BioGRID, IntAct, MINT INSR Affinity Capture-Western, pull down physical, physical association 1331107 , 9593725 , (Europe PMC )0.40 BioGRID, IntAct, MINT KDR Affinity Capture-Western physical 10319320 , (Europe PMC )NA BioGRID KHDRBS1 Affinity Capture-Western, Reconstituted Complex physical 11604231 , 1385407 , 1545818 , 8189062 , 8419471 , 9743338 , (Europe PMC )NA BioGRID LCK Biochemical Activity physical 11389730 , (Europe PMC )NA BioGRID MAP4K4 Affinity Capture-Western physical 10669731 , (Europe PMC )NA BioGRID NCK1 Affinity Capture-MS, Affinity Capture-Western, Far Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, far western blotting, mass spectrometry studies of complexes, pull down direct interaction, physical, physical association 21664272 , 9233798 , (Europe PMC )0.67 BioGRID, IntAct NFKBIA Phenotypic Suppression genetic 12151397 , (Europe PMC )NA BioGRID NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID OLIG1 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct PDGFRA Affinity Capture-Western physical 7682895 , (Europe PMC )NA BioGRID PDGFRB Affinity Capture-Western, coimmunoprecipitation association, physical 10697503 , 11896619 , 1314164 , 1375321 , 8382774 , (Europe PMC )0.64 BioGRID, IntAct, MINT PLCG1 Affinity Capture-Western, pull down physical, physical association 8977179 , 9020117 , 9743338 , (Europe PMC )0.40 BioGRID, IntAct, MINT PTK2B Affinity Capture-Western, Reconstituted Complex physical 10708762 , 10713673 , (Europe PMC )NA BioGRID PXN Affinity Capture-Western physical 10092539 , (Europe PMC )NA BioGRID RACK1 Affinity Capture-Western, Reconstituted Complex physical 11350068 , (Europe PMC )NA BioGRID SERPINA4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SLC9A2 Reconstituted Complex physical 10187839 , (Europe PMC )NA BioGRID SOCS1 Affinity Capture-Western physical 18556463 , (Europe PMC )NA BioGRID SOCS3 Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation, pull down association, physical 11331873 , (Europe PMC )0.46 BioGRID, IntAct, MINT SPSB1 Affinity Capture-Western physical 15713673 , (Europe PMC )NA BioGRID SRC Affinity Capture-Western, Biochemical Activity physical 11389730 , 1717825 , (Europe PMC )NA BioGRID TRMT2A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT XRCC6 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT YES1 Affinity Capture-Western physical 1544885 , (Europe PMC )NA BioGRID ZAP70 Affinity Capture-Western physical 7760813 , (Europe PMC )NA BioGRID ZNF579 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source APC two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT AR fluorescence polarization spectroscopy direct interaction 24728074 , (Europe PMC )0.44 IntAct ATF7 display technology physical association 20195357 , (Europe PMC )0.40 IntAct AURKA two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT BBS10 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT BCL10 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT BMPR1A two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT BUB1 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT CAPNS1 anti bait coimmunoprecipitation, competition binding physical association 18761085 , (Europe PMC )0.52 IntAct, MINT CAV1 protein array, pull down association, direct interaction 15504032 , 20808760 , (Europe PMC )0.59 IntAct, MINT CD5 Affinity Capture-Western, pull down association, physical 9603468 , (Europe PMC )0.35 BioGRID, IntAct, MINT CDKN2A two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT DCC two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT DLC1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid, two hybrid array physical association 19151751 , 24412244 , (Europe PMC )0.71 IntAct, MINT EGFR Protein-peptide, Reconstituted Complex, protein array direct interaction, physical 1385407 , 16273093 , 8647858 , (Europe PMC )0.44 BioGRID, IntAct, MINT EIF1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ERBB2 Protein-peptide, protein array, two hybrid array direct interaction, physical, physical association 16273093 , 24412244 , (Europe PMC )0.59 BioGRID, IntAct, MINT ERBB3 Protein-peptide, protein array direct interaction, physical 16273093 , (Europe PMC )0.44 BioGRID, IntAct, MINT ERBB4 Protein-peptide, protein array direct interaction, physical 16273093 , (Europe PMC )0.44 BioGRID, IntAct, MINT EZH2 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT FYB1 pull down association 22074159 , (Europe PMC )0.35 IntAct GAB1 coimmunoprecipitation, fluorescence polarization spectroscopy association, direct interaction 15574420 , 24728074 , (Europe PMC )0.59 IntAct, MINT HRAS Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Reconstituted Complex, x-ray crystallography direct interaction, physical 11389730 , 26721396 , 7628625 , 9219684 , (Europe PMC )0.44 BioGRID, IntAct IGF1R Affinity Capture-Western, Reconstituted Complex, pull down association, physical 7642582 , (Europe PMC )0.35 BioGRID, IntAct, MINT INSR Affinity Capture-Western, pull down physical, physical association 1331107 , 9593725 , (Europe PMC )0.40 BioGRID, IntAct, MINT KHDRBS1 pull down physical association 7537265 , (Europe PMC )0.40 IntAct KIT fluorescence polarization spectroscopy direct interaction 24728074 , (Europe PMC )0.44 IntAct MET fluorescence polarization spectroscopy direct interaction 24728074 , (Europe PMC )0.44 IntAct MLH3 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT NCK1 Affinity Capture-MS, Affinity Capture-Western, Far Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, far western blotting, mass spectrometry studies of complexes, pull down direct interaction, physical, physical association 21664272 , 9233798 , (Europe PMC )0.67 BioGRID, IntAct NRAS two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT OLIG1 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct PDGFRB Affinity Capture-Western, coimmunoprecipitation association, physical 10697503 , 11896619 , 1314164 , 1375321 , 8382774 , (Europe PMC )0.64 BioGRID, IntAct, MINT PLCG1 Affinity Capture-Western, pull down physical, physical association 8977179 , 9020117 , 9743338 , (Europe PMC )0.40 BioGRID, IntAct, MINT PMS2 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT PTPRJ two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT RB1 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT SDC2 coimmunoprecipitation physical association 22471946 , (Europe PMC )0.40 IntAct SERPINA4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SMAD2 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT SOCS3 Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation, pull down association, physical 11331873 , (Europe PMC )0.46 BioGRID, IntAct, MINT STK11 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT TERF2IP anti tag coimmunoprecipitation physical association 25531777 , (Europe PMC )0.40 IntAct TRMT2A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TSC1 two hybrid physical association 17355907 , (Europe PMC )0.37 IntAct XRCC6 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF579 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source APC two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT AURKA two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT BBS10 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT BCL10 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT BMPR1A two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT BUB1 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT CAPNS1 anti bait coimmunoprecipitation, competition binding physical association 18761085 , (Europe PMC )0.52 IntAct, MINT CAV1 protein array, pull down association, direct interaction 15504032 , 20808760 , (Europe PMC )0.59 IntAct, MINT CD5 Affinity Capture-Western, pull down association, physical 9603468 , (Europe PMC )0.35 BioGRID, IntAct, MINT CDKN2A two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT DCC two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT DLC1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid, two hybrid array physical association 19151751 , 24412244 , (Europe PMC )0.71 IntAct, MINT EGFR Protein-peptide, Reconstituted Complex, protein array direct interaction, physical 1385407 , 16273093 , 8647858 , (Europe PMC )0.44 BioGRID, IntAct, MINT EIF1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ERBB2 Protein-peptide, protein array, two hybrid array direct interaction, physical, physical association 16273093 , 24412244 , (Europe PMC )0.59 BioGRID, IntAct, MINT ERBB3 Protein-peptide, protein array direct interaction, physical 16273093 , (Europe PMC )0.44 BioGRID, IntAct, MINT ERBB4 Protein-peptide, protein array direct interaction, physical 16273093 , (Europe PMC )0.44 BioGRID, IntAct, MINT EZH2 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT GAB1 coimmunoprecipitation, fluorescence polarization spectroscopy association, direct interaction 15574420 , 24728074 , (Europe PMC )0.59 IntAct, MINT IGF1R Affinity Capture-Western, Reconstituted Complex, pull down association, physical 7642582 , (Europe PMC )0.35 BioGRID, IntAct, MINT INSR Affinity Capture-Western, pull down physical, physical association 1331107 , 9593725 , (Europe PMC )0.40 BioGRID, IntAct, MINT MLH3 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT NRAS two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT PDGFRB Affinity Capture-Western, coimmunoprecipitation association, physical 10697503 , 11896619 , 1314164 , 1375321 , 8382774 , (Europe PMC )0.64 BioGRID, IntAct, MINT PLCG1 Affinity Capture-Western, pull down physical, physical association 8977179 , 9020117 , 9743338 , (Europe PMC )0.40 BioGRID, IntAct, MINT PMS2 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT PTPRJ two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT RB1 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT SERPINA4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SMAD2 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT SOCS3 Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation, pull down association, physical 11331873 , (Europe PMC )0.46 BioGRID, IntAct, MINT STK11 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT TRMT2A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT XRCC6 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF579 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABL1 Affinity Capture-Western physical 1571536 , (Europe PMC )NA BioGRID ANXA6 Far Western, Reconstituted Complex physical 10571081 , (Europe PMC )NA BioGRID APC two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT APP Reconstituted Complex physical 21832049 , (Europe PMC )NA BioGRID AR fluorescence polarization spectroscopy direct interaction 24728074 , (Europe PMC )0.44 IntAct ARHGAP35 Affinity Capture-Western, Reconstituted Complex physical 8189062 , 8419471 , 9034330 , (Europe PMC )NA BioGRID ATF7 display technology physical association 20195357 , (Europe PMC )0.40 IntAct AURKA two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT BBS10 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT BCL10 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT BMPR1A two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT BTRC Phenotypic Suppression genetic 12151397 , (Europe PMC )NA BioGRID BUB1 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT CAPNS1 anti bait coimmunoprecipitation, competition binding physical association 18761085 , (Europe PMC )0.52 IntAct, MINT CAV1 protein array, pull down association, direct interaction 15504032 , 20808760 , (Europe PMC )0.59 IntAct, MINT CAV2 Affinity Capture-Western, Reconstituted Complex physical 12091389 , (Europe PMC )NA BioGRID CD5 Affinity Capture-Western, pull down association, physical 9603468 , (Europe PMC )0.35 BioGRID, IntAct, MINT CDKN2A two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT CSK Reconstituted Complex physical 7544435 , (Europe PMC )NA BioGRID DCC two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT DLC1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid, two hybrid array physical association 19151751 , 24412244 , (Europe PMC )0.71 IntAct, MINT DNAJA3 Affinity Capture-Western, Reconstituted Complex physical 11116152 , (Europe PMC )NA BioGRID DOK1 Affinity Capture-Western, Protein-peptide, Reconstituted Complex physical 10688886 , 10799545 , 10822173 , 11551902 , 15151996 , 22974441 , 9008161 , 9478921 , 9822717 , (Europe PMC )NA BioGRID DOK2 Affinity Capture-Western physical 10822173 , 9478921 , (Europe PMC )NA BioGRID EGFR Protein-peptide, Reconstituted Complex, protein array direct interaction, physical 1385407 , 16273093 , 8647858 , (Europe PMC )0.44 BioGRID, IntAct, MINT EIF1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT EPHB2 Affinity Capture-Western, Reconstituted Complex physical 10644995 , 9233798 , (Europe PMC )NA BioGRID EPHB3 Affinity Capture-Western, Reconstituted Complex physical 9674711 , (Europe PMC )NA BioGRID ERBB2 Protein-peptide, protein array, two hybrid array direct interaction, physical, physical association 16273093 , 24412244 , (Europe PMC )0.59 BioGRID, IntAct, MINT ERBB3 Protein-peptide, protein array direct interaction, physical 16273093 , (Europe PMC )0.44 BioGRID, IntAct, MINT ERBB4 Protein-peptide, protein array direct interaction, physical 16273093 , (Europe PMC )0.44 BioGRID, IntAct, MINT EZH2 Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID EZH2 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT FGFR1 Reconstituted Complex physical 8321198 , (Europe PMC )NA BioGRID FYB1 pull down association 22074159 , (Europe PMC )0.35 IntAct G3BP1 Affinity Capture-Western physical 9632780 , (Europe PMC )NA BioGRID GAB1 coimmunoprecipitation, fluorescence polarization spectroscopy association, direct interaction 15574420 , 24728074 , (Europe PMC )0.59 IntAct, MINT GRB2 Affinity Capture-Western physical 12441060 , (Europe PMC )NA BioGRID HCK Affinity Capture-Western, Reconstituted Complex physical 7782336 , (Europe PMC )NA BioGRID HNRNPL Affinity Capture-RNA physical 28611215 , (Europe PMC )NA BioGRID HRAS Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Reconstituted Complex, x-ray crystallography direct interaction, physical 11389730 , 26721396 , 7628625 , 9219684 , (Europe PMC )0.44 BioGRID, IntAct HTT Affinity Capture-Western, Reconstituted Complex physical 9079622 , (Europe PMC )NA BioGRID IGF1R Affinity Capture-Western, Reconstituted Complex, pull down association, physical 7642582 , (Europe PMC )0.35 BioGRID, IntAct, MINT INSR Affinity Capture-Western, pull down physical, physical association 1331107 , 9593725 , (Europe PMC )0.40 BioGRID, IntAct, MINT KDR Affinity Capture-Western physical 10319320 , (Europe PMC )NA BioGRID KHDRBS1 Affinity Capture-Western, Reconstituted Complex physical 11604231 , 1385407 , 1545818 , 8189062 , 8419471 , 9743338 , (Europe PMC )NA BioGRID KHDRBS1 pull down physical association 7537265 , (Europe PMC )0.40 IntAct KIT fluorescence polarization spectroscopy direct interaction 24728074 , (Europe PMC )0.44 IntAct LCK Biochemical Activity physical 11389730 , (Europe PMC )NA BioGRID MAP4K4 Affinity Capture-Western physical 10669731 , (Europe PMC )NA BioGRID MET fluorescence polarization spectroscopy direct interaction 24728074 , (Europe PMC )0.44 IntAct MLH3 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT NCK1 Affinity Capture-MS, Affinity Capture-Western, Far Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, far western blotting, mass spectrometry studies of complexes, pull down direct interaction, physical, physical association 21664272 , 9233798 , (Europe PMC )0.67 BioGRID, IntAct NFKBIA Phenotypic Suppression genetic 12151397 , (Europe PMC )NA BioGRID NRAS two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID OLIG1 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct PDGFRA Affinity Capture-Western physical 7682895 , (Europe PMC )NA BioGRID PDGFRB Affinity Capture-Western, coimmunoprecipitation association, physical 10697503 , 11896619 , 1314164 , 1375321 , 8382774 , (Europe PMC )0.64 BioGRID, IntAct, MINT PLCG1 Affinity Capture-Western, pull down physical, physical association 8977179 , 9020117 , 9743338 , (Europe PMC )0.40 BioGRID, IntAct, MINT PMS2 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT PTK2B Affinity Capture-Western, Reconstituted Complex physical 10708762 , 10713673 , (Europe PMC )NA BioGRID PTPRJ two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT PXN Affinity Capture-Western physical 10092539 , (Europe PMC )NA BioGRID RACK1 Affinity Capture-Western, Reconstituted Complex physical 11350068 , (Europe PMC )NA BioGRID RB1 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT SDC2 coimmunoprecipitation physical association 22471946 , (Europe PMC )0.40 IntAct SERPINA4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SLC9A2 Reconstituted Complex physical 10187839 , (Europe PMC )NA BioGRID SMAD2 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT SOCS1 Affinity Capture-Western physical 18556463 , (Europe PMC )NA BioGRID SOCS3 Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation, pull down association, physical 11331873 , (Europe PMC )0.46 BioGRID, IntAct, MINT SPSB1 Affinity Capture-Western physical 15713673 , (Europe PMC )NA BioGRID SRC Affinity Capture-Western, Biochemical Activity physical 11389730 , 1717825 , (Europe PMC )NA BioGRID STK11 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT TERF2IP anti tag coimmunoprecipitation physical association 25531777 , (Europe PMC )0.40 IntAct TRMT2A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TSC1 two hybrid physical association 17355907 , (Europe PMC )0.37 IntAct XRCC6 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT YES1 Affinity Capture-Western physical 1544885 , (Europe PMC )NA BioGRID ZAP70 Affinity Capture-Western physical 7760813 , (Europe PMC )NA BioGRID ZNF579 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
EGFR Y283_EPVEDRRyVRAILPY , Y460_TVDGKEIyNTIRRKT , LTP, in vitro, in vivo 1850098 ,(Europe PMC )HPRD, PhosphoELM , LCK Y283_EPVEDRRyVRAILPY , Y460_TVDGKEIyNTIRRKT , in vitro, in vivo 1850098 ,(Europe PMC )HPRD, PDGFR_group Y460_TVDGKEIyNTIRRKT , LTP 1850098 ,(Europe PMC )PhosphoELM , Unknown S650_VFDDLPPsINRFEIT , S827_KIMESKQsCELSPSK , Y438_IVEGYYLyEPVPMQD , Y615_VKHFTNPyCNIYLNS , HTP, in vivo 15592455 , 18083107 , 18452278 ,(Europe PMC )HPRD, PhosphoELM ,