- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
PRKAR2A
Gene Name  | PRKAR2A (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: 5H78 |
| Synonyms | PRKAR2A, PKR2, PRKAR2 | |
| Protein Name | PRKAR2A | |
| Alternative Name(s) | cAMP-dependent protein kinase type II-alpha regulatory subunit; | |
| Protein Family | Belongs to the cAMP-dependent kinase regulatory chainfamily | |
| EntrezGene ID | 5576 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P13861 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 45518 Dalton | |
| Protein Length | 404 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000114302 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - KOG1113 | eggNOG - COG0664 | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm Cell membrane Note=Colocalizes withPJA2 in the cytoplasm and the cell membrane | |||
| Function (UniProt annotation) | |||
| Regulatory subunit of the cAMP-dependent protein kinasesinvolved in cAMP signaling in cells Type II regulatory chainsmediate membrane association by binding to anchoring proteins,including the MAP2 kinase | |||
| Catalytic Activity (UniProt annotation) | |||
| N/A | |||
| Protein Sequence | |||
| MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDRVADAKGDSES EEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIHPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFERIV KADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRI IVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDG GNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSVDLG NLGQ | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0003091 | P:renal water homeostasis |
| GO:0004862 | F:cAMP-dependent protein kinase inhibitor activity |
| GO:0005737 | C:cytoplasm |
| GO:0005813 | C:centrosome |
| GO:0005829 | C:cytosol |
| GO:0005886 | C:plasma membrane |
| GO:0005925 | C:focal adhesion |
| GO:0005952 | C:cAMP-dependent protein kinase complex |
| GO:0007596 | P:blood coagulation |
| GO:0008603 | F:cAMP-dependent protein kinase regulator activity |
| GO:0016020 | C:membrane |
| GO:0019904 | F:protein domain specific binding |
| GO:0030552 | F:cAMP binding |
| GO:0031588 | C:nucleotide-activated protein kinase complex |
| GO:0031625 | F:ubiquitin protein ligase binding |
| GO:0032991 | C:protein-containing complex |
| GO:0034199 | P:activation of protein kinase A activity |
| GO:0034236 | F:protein kinase A catalytic subunit binding |
| GO:0035556 | P:intracellular signal transduction |
| GO:0044853 | C:plasma membrane raft |
| GO:0070062 | C:extracellular exosome |
| GO:0071377 | P:cellular response to glucagon stimulus |
| GO:0097546 | C:ciliary base |
| GO:2000480 | P:negative regulation of cAMP-dependent protein kinase activity |
PRKAR2A is dephosphorylated by following phosphatases:
| Phosphatase Gene Name | Phosphatase UniProt_AC | DephosphoSite and sequence (+/-5) in PRKAR2A (P13861) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| PPP3CA | Q08209 | NA | In vitro | 9660947, | Europe PMC |  |
| PPP3CB | P16298 | NA | In vitro | 9660947, | Europe PMC | |
| PPP3CC | P48454 | NA | In vitro | 9660947, | Europe PMC | |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| hsa04910 | Insulin signaling pathway | Insulin binding to its receptor results in the tyrosine phosphorylation of insulin receptor substrates (IRS) by the insulin receptor tyrosine kinase (INSR). This allows association of IRSs with the regulatory subunit of phosphoinositide 3-kinase (PI3K). PI3K activates 3-phosphoinositide-dependent protein kinase 1 (PDK1), which activates Akt, a serine kinase. Akt in turn deactivates glycogen synthase kinase 3 (GSK-3), leading to activation of glycogen synthase (GYS) and thus glycogen synthesis. Activation of Akt also results in the translocation of GLUT4 vesicles from their intracellular pool to the plasma membrane, where they allow uptake of glucose into the cell. Akt also leads to mTOR-mediated activation of protein synthesis by eIF4 and p70S6K. The translocation of GLUT4 protein is also elicited through the CAP/Cbl/TC10 pathway, once Cbl is phosphorylated by INSR.Other signal transduction proteins interact with IRS including GRB2. GRB2 is part of the cascade including SOS, RAS, RAF and MEK that leads to activation of mitogen-activated protein kinase (MAPK) and mitogenic responses in the form of gene transcription. SHC is another substrate of INSR. When tyrosine phosphorylated, SHC associates with GRB2 and can thus activate the RAS/MAPK pathway independently of IRS-1. |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-163615 | PKA activation. | A number of inactive tetrameric PKA holoenzymes are produced by the combination of homo- or heterodimers of the different regulatory subunits associated with two catalytic subunits. When cAMP binds to two specific binding sites on the regulatory subunits, these undergo a conformational change that causes the dissociation of a dimer of regulatory subunits bound to four cAMP from two monomeric, catalytically active PKA subunits |
| R-HSA-164378 | PKA activation in glucagon signalling. | Adenylate cyclase catalyses the synthesis of cyclic AMP (cAMP) from ATP. In the absence of cAMP, protein kinase A (PKA) exists as inactive tetramers of two catalytic subunits and two regulatory subunits. cAMP binding to PKA tetramers causes them to dissociate and release their catalytic subunits as active monomers. Four isoforms of the regulatory subunit are known, that differ in their tissue specificity and functional characteristics, but the specific isoform activated in response to glucagon signaling has not yet been identified |
| R-HSA-180024 | DARPP-32 events. | Dopamine- and cAMP-regulated phosphoprotein, Mr 32 kDa (DARPP-32), was identified as a major target for dopamine and protein kinase A (PKA) in striatum. Recent advances now indicate that regulation DARPP-32 phosphorylation provides a mechanism for integrating information arriving at dopaminoceptive neurons, in multiple brain regions, via a variety of neurotransmitters, neuromodulators, neuropeptides, and steroid hormones. Activation of PKA or PKG stimulates DARPP-32 phosphorylation at Thr34, converting DARPP-32 into a potent inhibitor of protein phosphatase-1 (PP-1). DARPP-32 is also phosphorylated at Thr75 by Cdk5, converting DARPP-32 into an inhibitor of PKA. Thus, DARPP-32 has the unique property of being a dual-function protein, acting either as an inhibitor of PP-1 or of PKA |
| R-HSA-381676 | Glucagon-like Peptide-1 (GLP1) regulates insulin secretion. | Glucagon-like Peptide-1 (GLP-1) is secreted by L-cells in the intestine in response to glucose and fatty acids. GLP-1 circulates to the beta cells of the pancreas where it binds a G-protein coupled receptor, GLP-1R, on the plasma membrane. The binding activates the heterotrimeric G-protein G(s), causing the alpha subunit of G(s) to exchange GDP for GTP and dissociate from the beta and gamma subunits.The activated G(s) alpha subunit interacts with Adenylyl Cyclase VIII (Adenylate Cyclase VIII, AC VIII) and activates AC VIII to produce cyclic AMP (cAMP). cAMP then has two effects: 1) cAMP activates Protein Kinase A (PKA), and 2) cAMP activates Epac1 and Epac2, two guanyl nucleotide exchange factors.Binding of cAMP to PKA causes the catalytic subunits of PKA to dissociate from the regulatory subunits and become an active kinase. PKA is known to enhance insulin secretion by closing ATP-sensitive potassium channels, closing voltage-gated potassium channels, releasing calcium from the endoplasmic reticulum, and affecting insulin secretory granules. The exact mechanisms for PKA's action are not fully known. After prolonged increases in cAMP, PKA translocates to the nucleus where it regulates the PDX-1 and CREB transcription factors, activating transcription of the insulin gene.cAMP produced by AC VIII also activates Epac1 and Epac2, which catalyze the exchange of GTP for GDP on G-proteins, notably Rap1A.. Rap1A regulates insulin secretory granules and is believed to activate the Raf/MEK/ERK mitogenic pathway leading to proliferation of beta cells. The Epac proteins also interact with RYR calcium channels on the endoplasmic reticulum, the SUR1 subunits of ATP-sensitive potassium channels, and the Piccolo:Rim2 calcium sensor at the plasma membrane |
| R-HSA-432040 | Vasopressin regulates renal water homeostasis via Aquaporins. | In the kidney water and solutes are passed out of the bloodstream and into the proximal tubule via the slit-like structure formed by nephrin in the glomerulus. Water is reabsorbed from the filtrate during its transit through the proximal tubule, the descending loop of Henle, the distal convoluted tubule, and the collecting duct.Aquaporin-1 (AQP1) in the proximal tubule and the descending thin limb of Henle is responsible for about 90% of reabsorption (as estimated from mouse knockouts of AQP1). AQP1 is located on both the apical and basolateral surface of epithelial cells and thus transports water through the epithelium and back into the bloodstream.In the collecting duct epithelial cells have AQP2 on their apical surface and AQP3 and AQP4 on their basolateral surface to transport water across the epithelium. The permeability of the epithelium is regulated by vasopressin, which activates the phosphorylation and subsequent translocation of AQP2 from intracellular vesicles to the plasma membrane |
| R-HSA-5610787 | Hedgehog 'off' state. | Hedgehog is a secreted morphogen that has evolutionarily conserved roles in body organization by regulating the activity of the Ci/Gli transcription factor family. In Drosophila in the absence of Hh signaling, full-length Ci is partially degraded by the proteasome to generate a truncated repressor form that translocates to the nucleus to represses Hh-responsive genes. Binding of Hh ligand to the Patched (PTC) receptor allows the 7-pass transmembrane protein Smoothened (SMO) to be activated in an unknown manner, disrupting the partial proteolysis of Ci and allowing the full length activator form to accumulate (reviewed in Ingham et al, 2011; Briscoe and Therond, 2013). While many of the core components of Hh signaling are conserved from flies to humans, the pathways do show points of significant divergence. Notably, the human genome encodes three Ci homologues, GLI1, 2 and 3 that each play slightly different roles in regulating Hh responsive genes. GLI3 is the primary repressor of Hh signaling in vertebrates, and is converted to the truncated GLI3R repressor form in the absence of Hh. GLI2 is a potent activator of transcription in the presence of Hh but contributes only minimally to the repression function. While a minor fraction of GLI2 protein is processed into the repressor form in the absence of Hh, the majority is either fully degraded by the proteasome or sequestered in the full-length form in the cytosol by protein-protein interactions. GLI1 lacks the repression domain and appears to be an obligate transcriptional activator (reviewed in Briscoe and Therond, 2013). Vertebrate but not fly Hh signaling also depends on the movement of pathway components through the primary cilium. The primary cilium is a non-motile microtubule based structure whose construction and maintenance depends on intraflagellar transport (IFT). Anterograde IFT moves molecules from the ciliary base along the axoneme to the ciliary tip in a manner that requires the microtubule-plus-end directed kinesin KIF3 motor complex and the IFT-B protein complex, while retrograde IFT back to the ciliary base depends on the minus-end directed dynein motor and the IFT-A complex. Genetic screens have identified a number of cilia-related proteins that are required both to maintain Hh in the 'off' state and to transduce the signal when the pathway is activated (reviewed in Hui and Angers, 2011; Goetz and Anderson, 2010) |
| R-HSA-9010642 | ROBO receptors bind AKAP5. | AKAP5 (also known as AKAP79 in humans and Akap150 in mice) is an A-kinase anchoring protein which is able to bind to ROBO receptors ROBO2 and ROBO3.1, an isoform of ROBO3, by interacting with their cytoplasmic tails. The interaction was originally detected between endogenous proteins from the mouse brain lysates. AKAP5 can recruit protein kinase A (PKA), protein kinase C (PKC) and protein phosphatase PP2B to ROBO2. AKAP5-mediated recruitment of PKC to ROBO3.1 leads to phosphorylation of ROBO3.1 by PKC. Functional implications of AKAP5 interaction with ROBO receptors are not known (Samelson et al. 2015) |
| R-HSA-983231 | Factors involved in megakaryocyte development and platelet production. | Megakaryocytes (MKs) give rise to circulating platelets (thrombocytes) through terminal differentiation of MKs which release cytoplasmic fragments as circulating platelets. As MKs mature they undergo endoreduplication (polyploidisation) and expansion of cytoplasmic mass to cell sizes larger than 50-100 microns, and ploidy ranges up to 128 N. As MKs mature, the polyploid nucleus becomes horseshoe-shaped, the cytoplasm expands, and platelet organelles and the demarcation membrane system are amplified. Proplatelet projections form which give rise to de novo circulating platelets (Deutsch & Tomer 2006). The processes of megakaryocytopoiesis and platelet production occur within a complex microenvironment where chemokines, cytokines and adhesive interactions play major roles (Avecilla et al. 2004). Megakaryocytopoiesis is regulated at several levels including proliferation, differentiation and platelet release (Kaushansky 2003). Thrombopoietin (TPO/c-Mpl ligand) is the most potent cytokine stimulating proliferation and maturation of MK progenitors (Kaushansky 2005) but many other growth factors are involved. MK development is controlled by the action of multiple transcription factors. Many MK-specific genes are co-regulated by GATA and friend of GATA (FOG), RUNX1 and ETS proteins. Nuclear factor erythroid 2 (NF-E2), which has an MK-erythroid specific 45-kDa subunit, controls terminal MK maturation, proplatelet formation and platelet release (Schulze & Shivdasani 2004). NF-E2 deficient mice have profound thrombocytopenia (Shiraga et al. 1999). MYB (c-myb) functions with EP300 (p300) as a negative regulator of thrombopoiesis (Metcalf et al. 2005). During MK maturation, internal membrane systems, granules and organelles are assembled. Cytoplasmic fragmentation requires changes in the MK cytoskeleton and formation of organelles and channels. Individual organelles migrate from the cell body to the proplatelet ends, with approximately 30 percent of organelles/granules in motion at any given time (Richardson et al. 2005) |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AKAP1 | Affinity Capture-MS, Far Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, filter binding | association, physical, physical association | 10413680, 10764601, 16642035, 24083380, 26496610, (Europe PMC) | 0.69 | BioGRID, IntAct, MINT |
| AKAP11 | Affinity Capture-Western, Protein-peptide, Reconstituted Complex | physical | 12147701, 12672969, 8621616, (Europe PMC) | NA | BioGRID |
| AKAP12 | Affinity Capture-Western, filter binding | physical, physical association | 11316952, 16642035, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| AKAP13 | Protein-peptide, Reconstituted Complex | physical | 12672969, 15383279, 1618839, (Europe PMC) | NA | BioGRID |
| AKAP14 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, two hybrid array, two hybrid prey pooling approach | physical, physical association | 12475942, 26186194, 28514442, (Europe PMC) | 0.49 | BioGRID, IntAct |
| AKAP2 | Far Western, Protein-peptide, Reconstituted Complex | physical | 12672969, 9497389, (Europe PMC) | NA | BioGRID |
| AKAP3 | Far Western, Reconstituted Complex, Two-hybrid, pull down, two hybrid | physical, physical association | 10319321, 11278869, (Europe PMC) | 0.51 | BioGRID, IntAct |
| AKAP4 | Reconstituted Complex | physical | 9852104, (Europe PMC) | NA | BioGRID |
| AKAP5 | Affinity Capture-MS, Protein-peptide, anti tag coimmunoprecipitation, filter binding, fluorescent resonance energy transfer, molecular sieving | association, direct interaction, physical, physical association | 12672969, 16642035, 22343722, 26496610, (Europe PMC) | 0.77 | BioGRID, IntAct, MINT |
| AKAP6 | Protein-peptide | physical | 12672969, (Europe PMC) | NA | BioGRID |
| AKAP7 | Protein-peptide, two hybrid array, two hybrid prey pooling approach | physical, physical association | 12672969, (Europe PMC) | 0.49 | BioGRID, IntAct |
| AKAP8 | Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, far western blotting, fluorescence microscopy | colocalization, direct interaction, physical, physical association | 10601332, 9473338, (Europe PMC) | 0.57 | BioGRID, IntAct |
| AKAP9 | Affinity Capture-Western, Protein-peptide | physical | 10358086, 12672969, (Europe PMC) | NA | BioGRID |
| ARFGEF2 | Reconstituted Complex, Two-hybrid | physical | 12571360, (Europe PMC) | NA | BioGRID |
| CBFA2T3 | Affinity Capture-Western, Reconstituted Complex | physical | 11823486, (Europe PMC) | NA | BioGRID |
| CEP170P1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CIRBP | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| CLTC | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CSNK1E | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CSRP1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| DLD | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DYNLL1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ELAVL1 | Affinity Capture-RNA | physical | 19322201, (Europe PMC) | NA | BioGRID |
| FGFR1OP | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GCH1 | Affinity Capture-MS | physical | 19294699, (Europe PMC) | NA | BioGRID |
| GNA13 | Affinity Capture-Western | physical | 11696326, (Europe PMC) | NA | BioGRID |
| GPS1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| GSK3B | Affinity Capture-Western | physical | 12147701, (Europe PMC) | NA | BioGRID |
| IMPDH2 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| KCNQ1 | Affinity Capture-Western | physical | 11799244, (Europe PMC) | NA | BioGRID |
| KEAP1 | Affinity Capture-MS | physical | 27621311, (Europe PMC) | NA | BioGRID |
| KPNA6 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| MAPRE1 | Affinity Capture-MS, anti tag coimmunoprecipitation, split luciferase complementation | association, physical, physical association | 26496610, 27107012, (Europe PMC) | 0.35, 0.37 | BioGRID, IntAct |
| OFD1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PCNT | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PDE4A | Affinity Capture-Western | physical | 11296225, (Europe PMC) | NA | BioGRID |
| PJA2 | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation | physical, physical association | 21423175, 24083380, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PRKACA | Affinity Capture-MS, Co-fractionation, protein kinase assay, tandem affinity purification | association, phosphorylation reaction, physical | 23455922, 24605759, 26344197, (Europe PMC) | 0.59 | BioGRID, IntAct |
| PRKACB | Affinity Capture-MS, Co-fractionation, tandem affinity purification | association, physical | 22939629, 23455922, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PRKAR2B | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26186194, 26496610, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PTPN22 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| RAB32 | Far Western, Protein-peptide, Two-hybrid | physical | 12186851, 12672969, (Europe PMC) | NA | BioGRID |
| RUNX1T1 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 11593431, (Europe PMC) | NA | BioGRID |
| RYR2 | Co-fractionation | physical | 10830164, (Europe PMC) | NA | BioGRID |
| SCLT1 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SEC16A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SUZ12 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| VCP | Affinity Capture-MS | physical | 23383273, (Europe PMC) | NA | BioGRID |
| WASF1 | Reconstituted Complex | physical | 10970852, (Europe PMC) | NA | BioGRID |
| XPO1 | Affinity Capture-MS | physical | 26673895, (Europe PMC) | NA | BioGRID |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AKAP12 | Affinity Capture-Western, filter binding | physical, physical association | 11316952, 16642035, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| AKAP14 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, two hybrid array, two hybrid prey pooling approach | physical, physical association | 12475942, 26186194, 28514442, (Europe PMC) | 0.49 | BioGRID, IntAct |
| AKAP3 | Far Western, Reconstituted Complex, Two-hybrid, pull down, two hybrid | physical, physical association | 10319321, 11278869, (Europe PMC) | 0.51 | BioGRID, IntAct |
| AKAP5 | Affinity Capture-MS, Protein-peptide, anti tag coimmunoprecipitation, filter binding, fluorescent resonance energy transfer, molecular sieving | association, direct interaction, physical, physical association | 12672969, 16642035, 22343722, 26496610, (Europe PMC) | 0.77 | BioGRID, IntAct, MINT |
| AKAP7 | Protein-peptide, two hybrid array, two hybrid prey pooling approach | physical, physical association | 12672969, (Europe PMC) | 0.49 | BioGRID, IntAct |
| AKAP8 | Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, far western blotting, fluorescence microscopy | colocalization, direct interaction, physical, physical association | 10601332, 9473338, (Europe PMC) | 0.57 | BioGRID, IntAct |
| CAV1 | anti bait coimmunoprecipitation | physical association | 19706440, (Europe PMC) | 0.40 | IntAct |
| CCND3 | anti tag coimmunoprecipitation | physical association | 16721056, (Europe PMC) | 0.40 | IntAct |
| CCNE1 | anti tag coimmunoprecipitation | physical association | 16721056, (Europe PMC) | 0.40 | IntAct |
| CEP170P1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CLTC | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CSNK1E | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DLD | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DYNLL1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FGFR1OP | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| LAMP1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| MAP1LC3A | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| MAPK6 | anti tag coimmunoprecipitation | association | 26972000, (Europe PMC) | 0.35 | IntAct |
| MAPRE1 | Affinity Capture-MS, anti tag coimmunoprecipitation, split luciferase complementation | association, physical, physical association | 26496610, 27107012, (Europe PMC) | 0.35, 0.37 | BioGRID, IntAct |
| OFD1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PCNT | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PDE4DIP | fluorescence microscopy, two hybrid | colocalization, physical association | 21569246, (Europe PMC) | 0.44 | IntAct |
| PJA2 | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation | physical, physical association | 21423175, 24083380, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PRKACA | Affinity Capture-MS, Co-fractionation, protein kinase assay, tandem affinity purification | association, phosphorylation reaction, physical | 23455922, 24605759, 26344197, (Europe PMC) | 0.59 | BioGRID, IntAct |
| PRKACB | Affinity Capture-MS, Co-fractionation, tandem affinity purification | association, physical | 22939629, 23455922, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PRKAR2B | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26186194, 26496610, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SCLT1 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SEC16A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SFN | two hybrid | physical association | 11414803, (Europe PMC) | 0.37 | IntAct, MINT |
| TOMM20 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TOMM22 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AKAP12 | Affinity Capture-Western, filter binding | physical, physical association | 11316952, 16642035, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| AKAP5 | Affinity Capture-MS, Protein-peptide, anti tag coimmunoprecipitation, filter binding, fluorescent resonance energy transfer, molecular sieving | association, direct interaction, physical, physical association | 12672969, 16642035, 22343722, 26496610, (Europe PMC) | 0.77 | BioGRID, IntAct, MINT |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| SFN | two hybrid | physical association | 11414803, (Europe PMC) | 0.37 | IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AKAP1 | Affinity Capture-MS, Far Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, filter binding | association, physical, physical association | 10413680, 10764601, 16642035, 24083380, 26496610, (Europe PMC) | 0.69 | BioGRID, IntAct, MINT |
| AKAP11 | Affinity Capture-Western, Protein-peptide, Reconstituted Complex | physical | 12147701, 12672969, 8621616, (Europe PMC) | NA | BioGRID |
| AKAP12 | Affinity Capture-Western, filter binding | physical, physical association | 11316952, 16642035, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| AKAP13 | Protein-peptide, Reconstituted Complex | physical | 12672969, 15383279, 1618839, (Europe PMC) | NA | BioGRID |
| AKAP14 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, two hybrid array, two hybrid prey pooling approach | physical, physical association | 12475942, 26186194, 28514442, (Europe PMC) | 0.49 | BioGRID, IntAct |
| AKAP2 | Far Western, Protein-peptide, Reconstituted Complex | physical | 12672969, 9497389, (Europe PMC) | NA | BioGRID |
| AKAP3 | Far Western, Reconstituted Complex, Two-hybrid, pull down, two hybrid | physical, physical association | 10319321, 11278869, (Europe PMC) | 0.51 | BioGRID, IntAct |
| AKAP4 | Reconstituted Complex | physical | 9852104, (Europe PMC) | NA | BioGRID |
| AKAP5 | Affinity Capture-MS, Protein-peptide, anti tag coimmunoprecipitation, filter binding, fluorescent resonance energy transfer, molecular sieving | association, direct interaction, physical, physical association | 12672969, 16642035, 22343722, 26496610, (Europe PMC) | 0.77 | BioGRID, IntAct, MINT |
| AKAP6 | Protein-peptide | physical | 12672969, (Europe PMC) | NA | BioGRID |
| AKAP7 | Protein-peptide, two hybrid array, two hybrid prey pooling approach | physical, physical association | 12672969, (Europe PMC) | 0.49 | BioGRID, IntAct |
| AKAP8 | Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, far western blotting, fluorescence microscopy | colocalization, direct interaction, physical, physical association | 10601332, 9473338, (Europe PMC) | 0.57 | BioGRID, IntAct |
| AKAP9 | Affinity Capture-Western, Protein-peptide | physical | 10358086, 12672969, (Europe PMC) | NA | BioGRID |
| ARFGEF2 | Reconstituted Complex, Two-hybrid | physical | 12571360, (Europe PMC) | NA | BioGRID |
| CAV1 | anti bait coimmunoprecipitation | physical association | 19706440, (Europe PMC) | 0.40 | IntAct |
| CBFA2T3 | Affinity Capture-Western, Reconstituted Complex | physical | 11823486, (Europe PMC) | NA | BioGRID |
| CCND3 | anti tag coimmunoprecipitation | physical association | 16721056, (Europe PMC) | 0.40 | IntAct |
| CCNE1 | anti tag coimmunoprecipitation | physical association | 16721056, (Europe PMC) | 0.40 | IntAct |
| CEP170P1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CIRBP | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| CLTC | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CSNK1E | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CSRP1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| DLD | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DYNLL1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ELAVL1 | Affinity Capture-RNA | physical | 19322201, (Europe PMC) | NA | BioGRID |
| FGFR1OP | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GCH1 | Affinity Capture-MS | physical | 19294699, (Europe PMC) | NA | BioGRID |
| GNA13 | Affinity Capture-Western | physical | 11696326, (Europe PMC) | NA | BioGRID |
| GPS1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| GSK3B | Affinity Capture-Western | physical | 12147701, (Europe PMC) | NA | BioGRID |
| IMPDH2 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| KCNQ1 | Affinity Capture-Western | physical | 11799244, (Europe PMC) | NA | BioGRID |
| KEAP1 | Affinity Capture-MS | physical | 27621311, (Europe PMC) | NA | BioGRID |
| KPNA6 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| LAMP1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| MAP1LC3A | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| MAPK6 | anti tag coimmunoprecipitation | association | 26972000, (Europe PMC) | 0.35 | IntAct |
| MAPRE1 | Affinity Capture-MS, anti tag coimmunoprecipitation, split luciferase complementation | association, physical, physical association | 26496610, 27107012, (Europe PMC) | 0.35, 0.37 | BioGRID, IntAct |
| OFD1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PCNT | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PDE4A | Affinity Capture-Western | physical | 11296225, (Europe PMC) | NA | BioGRID |
| PDE4DIP | fluorescence microscopy, two hybrid | colocalization, physical association | 21569246, (Europe PMC) | 0.44 | IntAct |
| PJA2 | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation | physical, physical association | 21423175, 24083380, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PRKACA | Affinity Capture-MS, Co-fractionation, protein kinase assay, tandem affinity purification | association, phosphorylation reaction, physical | 23455922, 24605759, 26344197, (Europe PMC) | 0.59 | BioGRID, IntAct |
| PRKACB | Affinity Capture-MS, Co-fractionation, tandem affinity purification | association, physical | 22939629, 23455922, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PRKAR2B | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26186194, 26496610, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PTPN22 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| RAB32 | Far Western, Protein-peptide, Two-hybrid | physical | 12186851, 12672969, (Europe PMC) | NA | BioGRID |
| RUNX1T1 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 11593431, (Europe PMC) | NA | BioGRID |
| RYR2 | Co-fractionation | physical | 10830164, (Europe PMC) | NA | BioGRID |
| SCLT1 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SEC16A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SFN | two hybrid | physical association | 11414803, (Europe PMC) | 0.37 | IntAct, MINT |
| SUZ12 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| TOMM20 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TOMM22 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| VCP | Affinity Capture-MS | physical | 23383273, (Europe PMC) | NA | BioGRID |
| WASF1 | Reconstituted Complex | physical | 10970852, (Europe PMC) | NA | BioGRID |
| XPO1 | Affinity Capture-MS | physical | 26673895, (Europe PMC) | NA | BioGRID |
| Phosphorylating Kinases | Phosphoresidues | Detection Method | PubMed IDs | Source |
| PKA_group | S99_SRFNRRVsVCAETYN, | LTP | 11263724,(Europe PMC) | PhosphoELM, |
| PRKAR2A | S99_SRFNRRVsVCAETYN, | in vitro, in vivo | 18452278, 18669648, 19664995, 20068231, 20166139, 20230923, 6293815,(Europe PMC) | HPRD, |
| Unknown | S350_TNKPRAAsAYAVGDV, S48_REARAPAsVLPAATP, S58_PAATPRQsLGHPPPE, S78_VADAKGDsESEEDED, S80_DAKGDSEsEEDEDLE, T104_RVSVCAEtYNPDEEE, T54_ASVLPAAtPRQSLGH, Y105_VSVCAETyNPDEEEE, Y352_KPRAASAyAVGDVKC, | HTP, in vitro, in vivo | 17081983, 17287340, 17322306, 18088087, 18452278, 18669648, 18691976, 18707149, 18767875, 19007248, 19413330, 19415658, 19651622, 20058876, 20068231, 20166139, 20187088, 20230923, 6293815,(Europe PMC) | HPRD, PhosphoELM, |