Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
PNCK
Gene Name  | PNCK (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: NA |
| Synonyms | PNCK | |
| Protein Name | PNCK | |
| Alternative Name(s) | Calcium/calmodulin-dependent protein kinase type 1B;2.7.11.17;CaM kinase I beta;CaM kinase IB;CaM-KI beta;CaMKI-beta;Pregnancy up-regulated non-ubiquitously-expressed CaM kinase; | |
| Protein Family | Belongs to the protein kinase superfamily CAMKSer/Thr protein kinase family CaMK subfamily | |
| EntrezGene ID | 139728 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q6P2M8 (protein sequence) | |
| Enzyme Class | 2.7.11.17 (BRENDA ) | |
| Molecular Weight | 38500 Dalton | |
| Protein Length | 343 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000130822 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - KOG0032 | eggNOG - ENOG410XRMJ | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm Nucleus | |||
| Function (UniProt annotation) | |||
| Calcium/calmodulin-dependent protein kinase belonging toa proposed calcium-triggered signaling cascade In vitrophosphorylates CREB1 and SYN1/synapsin I Phosphorylates andactivates CAMK1 (By similarity) | |||
| Catalytic Activity (UniProt annotation) | |||
| ATP + a protein = ADP + a phosphoprotein | |||
| Protein Sequence | |||
| MLLLKKHTEDISSVYEIRERLGSGAFSEVVLAQERGSAHLVALKCIPKKALRGKEALVENEIAVLRRISHPNIVALEDVH ESPSHLYLAMELVTGGELFDRIMERGSYTEKDASHLVGQVLGAVSYLHSLGIVHRDLKPENLLYATPFEDSKIMVSDFGL SKIQAGNMLGTACGTPGYVAPELLEQKPYGKAVDVWALGVISYILLCGYPPFYDESDPELFSQILRASYEFDSPFWDDIS ESAKDFIRHLLERDPQKRFTCQQALRHLWISGDTAFDRDILGSVSEQIRKNFARTHWKRAFNATSFLRHIRKLGQIPEGE GASEQGMARHSHSGLRAGQPPKW | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0004683 | F:calmodulin-dependent protein kinase activity |
| GO:0005516 | F:calmodulin binding |
| GO:0005524 | F:ATP binding |
| GO:0005622 | C:intracellular |
| GO:0005634 | C:nucleus |
| GO:0005737 | C:cytoplasm |
| GO:0018105 | P:peptidyl-serine phosphorylation |
| GO:0018107 | P:peptidyl-threonine phosphorylation |
| GO:0035556 | P:intracellular signal transduction |
