Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
NEFH
Gene Name  | NEFH (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: NA |
| Synonyms | NEFH, KIAA0845, NFH | |
| Protein Name | NEFH | |
| Alternative Name(s) | Neurofilament heavy polypeptide;NF-H;200 kDa neurofilament protein;Neurofilament triplet H protein; | |
| Protein Family | Belongs to the intermediate filament family | |
| EntrezGene ID | 4744 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P12036 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 112479 Dalton | |
| Protein Length | 1026 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000100285 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - ENOG410IGME | eggNOG - ENOG410XPTM | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm | |||
| Function (UniProt annotation) | |||
| Neurofilaments usually contain three intermediatefilament proteins: L, M, and H which are involved in themaintenance of neuronal caliber NF-H has an important function inmature axons that is not subserved by the two smaller NF proteins | |||
| Catalytic Activity (UniProt annotation) | |||
| N/A | |||
| Protein Sequence | |||
| MMSFGGADALLGAPFAPLHGGGSLHYALARKGGAGGTRSAAGSSSGFHSWTRTSVSSVSASPSRFRGAGAASSTDSLDTL SNGPEGCMVAVATSRSEKEQLQALNDRFAGYIDKVRQLEAHNRSLEGEAAALRQQQAGRSAMGELYEREVREMRGAVLRL GAARGQLRLEQEHLLEDIAHVRQRLDDEARQREEAEAAARALARFAQEAEAARVDLQKKAQALQEECGYLRRHHQEEVGE LLGQIQGSGAAQAQMQAETRDALKCDVTSALREIRAQLEGHAVQSTLQSEEWFRVRLDRLSEAAKVNTDAMRSAQEEITE YRRQLQARTTELEALKSTKDSLERQRSELEDRHQADIASYQEAIQQLDAELRNTKWEMAAQLREYQDLLNVKMALDIEIA AYRKLLEGEECRIGFGPIPFSLPEGLPKIPSVSTHIKVKSEEKIKVVEKSEKETVIVEEQTEETQVTEEVTEEEEKEAKE EEGKEEEGGEEEEAEGGEEETKSPPAEEAASPEKEAKSPVKEEAKSPAEAKSPEKEEAKSPAEVKSPEKAKSPAKEEAKS PPEAKSPEKEEAKSPAEVKSPEKAKSPAKEEAKSPAEAKSPEKAKSPVKEEAKSPAEAKSPVKEEAKSPAEVKSPEKAKS PTKEEAKSPEKAKSPEKAKSPEKEEAKSPEKAKSPVKAEAKSPEKAKSPVKAEAKSPEKAKSPVKEEAKSPEKAKSPVKE EAKSPEKAKSPVKEEAKTPEKAKSPVKEEAKSPEKAKSPEKAKTLDVKSPEAKTPAKEEARSPADKFPEKAKSPVKEEVK SPEKAKSPLKEDAKAPEKEIPKKEEVKSPVKEEEKPQEVKVKEPPKKAEEEKAPATPKTEEKKDSKKEEAPKKEAPKPKV EEKKEPAVEKPKESKVEAKKEEAEDKKKVPTPEKEAPAKVEVKEDAKPKEKTEVAKKEPDDAKAKEPSKPAEKKEAAPEK KDTKEEKAKKPEEKPKTEAKAKEDDKTLSKEPSKPKAEKAEKSSSTDQKDSKPPEKATEDKAAKGK | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000226 | P:microtubule cytoskeleton organization |
| GO:0005198 | F:structural molecule activity |
| GO:0005200 | F:structural constituent of cytoskeleton |
| GO:0005737 | C:cytoplasm |
| GO:0005856 | C:cytoskeleton |
| GO:0005883 | C:neurofilament |
| GO:0007409 | P:axonogenesis |
| GO:0008017 | F:microtubule binding |
| GO:0014069 | C:postsynaptic density |
| GO:0019894 | F:kinesin binding |
| GO:0019901 | F:protein kinase binding |
| GO:0030031 | P:cell projection assembly |
| GO:0030424 | C:axon |
| GO:0030674 | F:protein binding |
| GO:0033693 | bridging |
| GO:0043209 | P:neurofilament bundle assembly |
| GO:0048936 | C:myelin sheath |
| GO:0060052 | P:peripheral nervous system neuron axonogenesis |
| GO:0061564 | P:neurofilament cytoskeleton organization |
| GO:0070840 | P:axon development |
| GO:0097418 | F:dynein complex binding |
| GO:0098685 | C:neurofibrillary tangle |
| GO:0099160 | C:Schaffer collateral - CA1 synapse |
| GO:0099184 | C:postsynaptic intermediate filament cytoskeleton |
| GO:1902513 | F:structural constituent of postsynaptic intermediate filament cytoskeleton |
| GO:1990830 | P:regulation of organelle transport along microtubule |
