- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
NCL
Gene Name  | NCL (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: 2FC9 |
| Synonyms | NCL | |
| Protein Name | NCL | |
| Alternative Name(s) | Nucleolin;Protein C23; | |
| Protein Family | noSimilarity_annotations | |
| EntrezGene ID | 4691 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P19338 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 76614 Dalton | |
| Protein Length | 710 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000115053 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - ENOG410IRS7 | eggNOG - ENOG410XSFV | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Nucleus, nucleolus CytoplasmNote=Localized in cytoplasmic mRNP granules containinguntranslated mRNAs | |||
| Function (UniProt annotation) | |||
| Nucleolin is the major nucleolar protein of growingeukaryotic cells It is found associated with intranucleolarchromatin and pre-ribosomal particles It induces chromatindecondensation by binding to histone H1 It is thought to play arole in pre-rRNA transcription and ribosome assembly May play arole in the process of transcriptional elongation Binds RNAoligonucleotides with 5'-UUAGGG-3' repeats more tightly than thetelomeric single-stranded DNA 5'-TTAGGG-3' repeats | |||
| Catalytic Activity (UniProt annotation) | |||
| N/A | |||
| Protein Sequence | |||
| MVKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATSAKKVVVSPTKKVAVATPAKK AAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDD EDEDEDEDEIEPAAMKAAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAKGKKAAKVVPVKAKNVAEDEDEEE DDEDEDDDDDEDDEDDDDEDDEEEEEEEEEEPVKEAPGKRKKEMAKQKAAPEAKKQKVEGTEPTTAFNLFVGNLNFNKSA PELKTGISDVFAKNDLAVVDVRIGMTRKFGYVDFESAEDLEKALELTGLKVFGNEIKLEKPKGKDSKKERDARTLLAKNL PYKVTQDELKEVFEDAAEIRLVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNST WSGESKTLVLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLELQGP RGSPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKV TLDWAKPKGEGGFGGRGGGRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDHKPQGKKTKFE | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| MOD_SUMO_rev_2 | 319-SAPELKT-325 | Sumoylation site | [SDE].{0,5}[DE].(K).{0,1}[AIFLMPSTV] |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0001525 | P:angiogenesis |
| GO:0003723 | F:RNA binding |
| GO:0005634 | C:nucleus |
| GO:0005654 | C:nucleoplasm |
| GO:0005730 | C:nucleolus |
| GO:0005938 | C:cell cortex |
| GO:0008022 | F:protein C-terminus binding |
| GO:0016020 | C:membrane |
| GO:0017148 | P:negative regulation of translation |
| GO:0036464 | C:cytoplasmic ribonucleoprotein granule |
| GO:0042162 | F:telomeric DNA binding |
| GO:0042802 | F:identical protein binding |
| GO:0044547 | F:DNA topoisomerase binding |
| GO:0045944 | P:positive regulation of transcription by RNA polymerase II |
| GO:0048027 | F:mRNA 5'-UTR binding |
| GO:0070062 | C:extracellular exosome |
| GO:0071364 | P:cellular response to epidermal growth factor stimulus |
| GO:1901838 | P:positive regulation of transcription of nucleolar large rRNA by RNA polymerase I |
| GO:1990830 | P:cellular response to leukemia inhibitory factor |
| GO:1990904 | C:ribonucleoprotein complex |
NCL is dephosphorylated by following phosphatases:
| Phosphatase Gene Name | Phosphatase UniProt_AC | DephosphoSite and sequence (+/-5) in NCL (P19338) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| PTP4A3 | O75365 | NA | In vivo | 20860603, | Europe PMC |  |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| hsa05130 | Pathogenic Escherichia coli infection | Enteropathogenic E. coli (EPEC) and enterohemorrhagic E. coli (EHEC) are closely related pathogenic strains of Escherichia coli. The hallmark of EPEC/EHEC infections [DS:H00278 H00277] is induction of attaching and effacing (A/E) lesions that damage intestinal epithelial cells. The capacity to form A/E lesions is encoded mainly by the locus of enterocyte effacement (LEE) pathogenicity island. Tir, Map, EspF, EspG are known LEE-encoded effector proteins secreted via the type III secretion system, which is also LEE-encoded, into the host cell. EPEC and EHEC Tir's link the extracellular bacterium to the cell cytoskeleton. Map and EspF are involved in mitochondrion membrane permeabilization. EspG interacts with tubulins and stimulates microtubule destabilization. LEE-encoded adhesin or intimin (Eae) is exported via the general secretory pathway to the periplasm, where it is inserted into the outer membrane. In addition to Tir, two potential host cell-carried intimin receptors, beta1 integrin (ITGB1) and nucleolin (NCL), have so far been identified. The distinguishing feature of EHEC is the elaboration of Shiga-like toxin (Stx). Stx cleaves ribosomal RNA, thereby disrupting protein synthesis and killing the intoxicated epithelial or endothelial cells. |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-6791226 | Major pathway of rRNA processing in the nucleolus and cytosol. | In humans, a 47S precursor rRNA (pre-rRNA) is transcribed by RNA polymerase I from rRNA-encoding genes (rDNA) at the boundary of the fibrillar center and the dense fibrillar components of the nucleolus (Stanek et al. 2001). The 47S precursor is processed over the course of about 5-8 minutes (Popov et al. 2013) by endoribonucleases and exoribonucleases to yield the 28S rRNA and 5.8S rRNA of the 60S subunit and the 18S rRNA of the 40S subunit (reviewed in Mullineus and Lafontaine 2012, Henras et al. 2015). As the pre-rRNA is being transcribed, a large protein complex, the small subunit (SSU) processome, assembles in the region of the 18S rRNA sequence, forming terminal knobs on the pre-rRNA (reviewed in Phipps et al. 2011, inferred from yeast in Dragon et al. 2002). The SSU processome contains both ribosomal proteins of the small subunit and processing factors which process the pre-rRNA and modify nucleotides. Through addition of subunits the SSU processome appears to be converted into the larger 90S pre-ribosome (inferred from yeast in Grandi et al. 2002). An analogous large subunit processome (LSU) assembles in the region of the 28S rRNA, however the LSU is less well characterized (inferred from yeast in McCann et al. 2015).Following cleavage of the pre-rRNA within internal transcribed spacer 1 (ITS1), the pre-ribosomal particle separates into a pre-60S subunit and a pre-40S subunit in the nucleolus (reviewed in Hernandez-Verdun et al. 2010, Phipps et al. 2011). The pre-60S and pre-40S ribosomal particles are then exported from the nucleus to the cytoplasm where the processing factors dissociate and recycle back to the nucleusNuclease digestions of the 47S pre-rRNA can follow several paths. In the major pathway, the ends of the 47S pre-rRNA are trimmed to yield the 45S pre-rRNA. Digestion at site 2 (also called site 2b in mouse, see Henras et al. 2015 for nomenclature) cleaves the 45S pre-rRNA to yield the 30S pre-rRNA containing the 18S rRNA of the small subunit and the 32S pre-rRNA containing the 5.8S rRNA and the 28S rRNA of the large subunit. The 32S pre-rRNA is digested in the nucleus to yield the 5.8S rRNA and the 28S rRNA while the 30S pre-rRNA is digested in the nucleus to yield the 18SE pre-rRNA which is then processed in the nucleus and cytosol to yield the 18S rRNA. At least 286 human proteins, 74 of which have no yeast homolog, are required for efficient processing of pre-rRNA in the nucleus (Tafforeau et al |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ACLY | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| ACTL6A | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| ACTN4 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| ADAP1 | Affinity Capture-Western, Co-purification, Reconstituted Complex | physical | 12565890, 18298663, (Europe PMC) | NA | BioGRID |
| ADAP2 | Reconstituted Complex | physical | 18298663, (Europe PMC) | NA | BioGRID |
| AKAP5 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ALYREF | Affinity Capture-MS, Affinity Capture-Western | physical | 27049334, (Europe PMC) | NA | BioGRID |
| ANAPC1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ANAPC7 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ANP32B | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ARFGEF1 | Affinity Capture-Western, anti bait coimmunoprecipitation | association, physical, physical association | 14973189, 18292223, (Europe PMC) | 0.50 | BioGRID, IntAct |
| ARRB1 | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical, physical association | 17620599, (Europe PMC) | 0.50 | BioGRID, IntAct |
| ARRB2 | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical, physical association | 17620599, (Europe PMC) | 0.50 | BioGRID, IntAct |
| AURKA | Affinity Capture-MS | physical | 23443559, (Europe PMC) | NA | BioGRID |
| BAG3 | Affinity Capture-MS | physical | 23824909, (Europe PMC) | NA | BioGRID |
| BMI1 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| BRCA1 | Affinity Capture-MS | physical | 26831064, (Europe PMC) | NA | BioGRID |
| BRIX1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| C7orf50 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| CAND1 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CBX5 | Affinity Capture-MS | physical | 20850016, (Europe PMC) | NA | BioGRID |
| CBX6 | Affinity Capture-MS, tandem affinity purification | association, physical | 21282530, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CBX8 | Affinity Capture-MS, tandem affinity purification | association, physical | 21282530, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CCDC8 | Affinity Capture-MS | physical | 24711643, (Europe PMC) | NA | BioGRID |
| CD3E | Reconstituted Complex | physical | 11115514, (Europe PMC) | NA | BioGRID |
| CD3EAP | Reconstituted Complex | physical | 23145133, (Europe PMC) | NA | BioGRID |
| CD4 | Affinity Capture-MS | physical | 15047060, (Europe PMC) | NA | BioGRID |
| CD81 | Affinity Capture-MS, Affinity Capture-Western | physical | 23463506, (Europe PMC) | NA | BioGRID |
| CDC27 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| CDC5L | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| CDC73 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| CDK1 | Biochemical Activity | physical | 24530506, (Europe PMC) | NA | BioGRID |
| CDK11A | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| CDKN1A | Affinity Capture-MS | physical | 23443559, (Europe PMC) | NA | BioGRID |
| CDKN2A | Affinity Capture-Western | physical | 14636574, (Europe PMC) | NA | BioGRID |
| CEP170 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| CHCHD3 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| CHD4 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| CLK1 | Biochemical Activity | physical | 26167880, (Europe PMC) | NA | BioGRID |
| COPS5 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| COPS6 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CRY2 | Affinity Capture-MS | physical | 25756610, (Europe PMC) | NA | BioGRID |
| CSNK2A1 | Biochemical Activity, Co-fractionation, protein kinase assay | phosphorylation reaction, physical | 22113938, 26344197, (Europe PMC) | 0.44 | BioGRID, IntAct |
| CSNK2A2 | Affinity Capture-Western, Biochemical Activity, Far Western | physical | 8663258, (Europe PMC) | NA | BioGRID |
| CTCF | Affinity Capture-Western | physical | 19450526, (Europe PMC) | NA | BioGRID |
| CUL1 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CUL2 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CUL3 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CUL4A | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CUL4B | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CUL5 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CUL7 | Affinity Capture-MS | physical | 24711643, (Europe PMC) | NA | BioGRID |
| CYFIP1 | Affinity Capture-Western | physical | 11438699, (Europe PMC) | NA | BioGRID |
| CYLD | Affinity Capture-MS | physical | 27591049, (Europe PMC) | NA | BioGRID |
| DAP3 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| DAXX | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| DCAF1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| DCAF4L2 | Affinity Capture-MS | physical | 27158335, (Europe PMC) | NA | BioGRID |
| DCUN1D1 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| DDX18 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| DDX21 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| DDX24 | Affinity Capture-Western | physical | 24980433, (Europe PMC) | NA | BioGRID |
| DDX41 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25920683, 27049334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DDX47 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| DDX50 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| DGCR8 | Affinity Capture-MS, Affinity Capture-Western | physical | 17765891, (Europe PMC) | NA | BioGRID |
| DHX15 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| DHX30 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| DHX9 | Affinity Capture-MS, Affinity Capture-Western | physical | 22751105, 27049334, (Europe PMC) | NA | BioGRID |
| DNM1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| EBNA1BP2 | Affinity Capture-MS, Co-fractionation | physical | 26344197, 27049334, 28514442, (Europe PMC) | NA | BioGRID |
| EED | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| EGFR | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation | association, physical | 24780295, 25261371, 28065597, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EIF3A | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| EIF3C | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| EIF3D | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| EIF3G | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| EIF3L | Co-fractionation | physical | 22939629, 26344197, (Europe PMC) | NA | BioGRID |
| EIF5B | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| EIF6 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| ELAVL1 | Affinity Capture-RNA | physical | 19322201, (Europe PMC) | NA | BioGRID |
| ERG | Affinity Capture-MS, Reconstituted Complex | physical | 24591637, (Europe PMC) | NA | BioGRID |
| ERH | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| ESR1 | Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology, cosedimentation through density gradient | association, physical | 20348541, 21182205, (Europe PMC) | 0.46 | BioGRID, IntAct |
| ETS1 | Reconstituted Complex, display technology | physical, physical association | 20195357, (Europe PMC) | 0.40 | BioGRID, IntAct |
| EXOSC10 | Affinity Capture-MS, Affinity Capture-Western | physical | 27049334, (Europe PMC) | NA | BioGRID |
| EXOSC2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, 27049334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EXOSC4 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| EXOSC9 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| EZH2 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| FBL | Affinity Capture-Western, anti bait coimmunoprecipitation | association, physical | 18292223, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FBXO25 | Affinity Capture-MS | physical | 20473970, (Europe PMC) | NA | BioGRID |
| FMR1 | Affinity Capture-Western | physical | 10567518, (Europe PMC) | NA | BioGRID |
| FN1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FTSJ3 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| FYTTD1 | Affinity Capture-MS | physical | 19836239, (Europe PMC) | NA | BioGRID |
| GAN | Affinity Capture-MS | physical | 26460568, (Europe PMC) | NA | BioGRID |
| GNL3 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| GRB2 | Two-hybrid, pull down, two hybrid pooling approach | association, physical, physical association | 12577067, 20936779, (Europe PMC) | 0.55 | BioGRID, IntAct |
| GRK5 | Affinity Capture-MS | physical | 22952844, (Europe PMC) | NA | BioGRID |
| GRWD1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| GTF2F1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| GTF3C1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| GTPBP4 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| GZF1 | Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex | physical | 17674968, (Europe PMC) | NA | BioGRID |
| H1FX | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| H2AFX | Reconstituted Complex | physical | 23145133, (Europe PMC) | NA | BioGRID |
| H3F3A | Affinity Capture-MS | physical | 17403666, (Europe PMC) | NA | BioGRID |
| HDAC6 | Affinity Capture-MS | physical | 26643866, (Europe PMC) | NA | BioGRID |
| HDGF | Affinity Capture-MS, tandem affinity purification | association, physical | 21907836, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HDGFL2 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| HIST1H1C | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex | physical | 18258596, (Europe PMC) | NA | BioGRID |
| HIST2H2AC | Reconstituted Complex | physical | 16601700, (Europe PMC) | NA | BioGRID |
| HIST2H2BE | Reconstituted Complex | physical | 16601700, (Europe PMC) | NA | BioGRID |
| HIST2H3A | Affinity Capture-MS | physical | 29104064, (Europe PMC) | NA | BioGRID |
| HIST3H3 | Protein-peptide | physical | 20850016, (Europe PMC) | NA | BioGRID |
| HMGA1 | Far Western, filter binding | association, physical | 18850631, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HNRNPA1 | Affinity Capture-MS | physical | 25324306, (Europe PMC) | NA | BioGRID |
| HNRNPD | Affinity Capture-Western | physical | 16571724, (Europe PMC) | NA | BioGRID |
| HNRNPK | Co-fractionation | physical | 22863883, 26344197, (Europe PMC) | NA | BioGRID |
| HNRNPR | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| HNRNPU | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| HSP90AA1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| HUWE1 | Affinity Capture-MS | physical | 25147182, (Europe PMC) | NA | BioGRID |
| ICAM1 | Affinity Capture-MS, Affinity Capture-Western | physical | 23463506, (Europe PMC) | NA | BioGRID |
| IFIT1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21642987, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IFIT3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21642987, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IGF2BP1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| IGSF8 | Affinity Capture-MS, Affinity Capture-Western | physical | 23463506, (Europe PMC) | NA | BioGRID |
| IL7R | Protein-RNA | physical | 23151878, (Europe PMC) | NA | BioGRID |
| ILF2 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| ILF3 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| IRF2 | Affinity Capture-MS, Affinity Capture-Western | physical | 16582966, (Europe PMC) | NA | BioGRID |
| ITGA4 | Affinity Capture-MS | physical | 22623428, (Europe PMC) | NA | BioGRID |
| ITGAV | Affinity Capture-MS, Affinity Capture-Western | physical | 23161541, (Europe PMC) | NA | BioGRID |
| KCTD12 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| KEAP1 | Affinity Capture-MS | physical | 27621311, (Europe PMC) | NA | BioGRID |
| KMT2A | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| KPNB1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| KRAS | Synthetic Lethality | genetic | 19490893, (Europe PMC) | NA | BioGRID |
| LASP1 | Affinity Capture-MS | physical | 25982273, (Europe PMC) | NA | BioGRID |
| LMNA | Affinity Capture-MS, Co-fractionation, Proximity Label-MS | physical | 22412018, 22863883, 25948554, (Europe PMC) | NA | BioGRID |
| LYAR | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| MAGED2 | Affinity Capture-Western | physical | 26705694, (Europe PMC) | NA | BioGRID |
| MCM2 | Affinity Capture-MS, Co-fractionation | physical | 22863883, 25963833, (Europe PMC) | NA | BioGRID |
| MCM5 | Affinity Capture-MS | physical | 25963833, (Europe PMC) | NA | BioGRID |
| MDC1 | Reconstituted Complex | physical | 23145133, (Europe PMC) | NA | BioGRID |
| MDK | Reconstituted Complex | physical | 12147681, (Europe PMC) | NA | BioGRID |
| MDM2 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, display technology, far western blotting, pull down | direct interaction, physical, physical association | 16751805, 20195357, 22103682, 24147044, (Europe PMC) | 0.71 | BioGRID, IntAct, MINT |
| MGMT | Affinity Capture-MS | physical | 16226712, (Europe PMC) | NA | BioGRID |
| MOGS | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| MRPS26 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| MRPS34 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| MRPS7 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| MRTO4 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| MSH6 | Affinity Capture-MS, Affinity Capture-Western | physical | 27049334, (Europe PMC) | NA | BioGRID |
| MTF1 | Affinity Capture-MS | physical | 28416769, (Europe PMC) | NA | BioGRID |
| MTPAP | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| MTREX | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| MYB | Affinity Capture-Western | physical | 10660576, (Europe PMC) | NA | BioGRID |
| MYBBP1A | Affinity Capture-MS | physical | 21386990, 27049334, (Europe PMC) | NA | BioGRID |
| MYBL1 | Affinity Capture-Western, Far Western | physical | 10660576, (Europe PMC) | NA | BioGRID |
| MYC | Affinity Capture-MS, tandem affinity purification | association, physical | 17314511, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NAP1L1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| NAP1L4 | Co-fractionation | physical | 22939629, 26344197, (Europe PMC) | NA | BioGRID |
| NBN | Reconstituted Complex | physical | 23145133, (Europe PMC) | NA | BioGRID |
| NCBP1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| NCL | Affinity Capture-Western, blue native page, surface plasmon resonance | direct interaction, physical | 21575138, 25313645, (Europe PMC) | 0.56 | BioGRID, IntAct, MINT |
| NDRG1 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17220478, (Europe PMC) | 0.40 | BioGRID, IntAct |
| NEDD8 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| NFE4 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 19234465, 22689669, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NFX1 | Affinity Capture-MS | physical | 17267499, (Europe PMC) | NA | BioGRID |
| NOC4L | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| NOP53 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| NOP56 | Affinity Capture-MS | physical | 12777385, (Europe PMC) | NA | BioGRID |
| NOP9 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NPM1 | Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, proximity ligation assay | physical, physical association | 16648475, 20431927, 21048921, 22362753, 22939629, 28514442, 8620867, (Europe PMC) | 0.40 | BioGRID, IntAct |
| NPM3 | Co-fractionation | physical | 22362753, 22863883, 26344197, (Europe PMC) | NA | BioGRID |
| NR3C1 | Reconstituted Complex | physical | 11162542, (Europe PMC) | NA | BioGRID |
| NSUN2 | Affinity Capture-Western | physical | 17215513, (Europe PMC) | NA | BioGRID |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| NUP62 | Affinity Capture-Western, anti bait coimmunoprecipitation | association, physical | 14973189, 18292223, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NXF1 | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 18596238, 27049334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| OBSL1 | Affinity Capture-MS | physical | 24711643, (Europe PMC) | NA | BioGRID |
| OXCT1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| PA2G4 | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, pull down | association, physical, physical association | 15064750, 19037095, 19946338, (Europe PMC) | 0.50 | BioGRID, IntAct |
| PABPC1 | Affinity Capture-Western | physical | 20221403, (Europe PMC) | NA | BioGRID |
| PAN2 | Affinity Capture-MS | physical | 23398456, (Europe PMC) | NA | BioGRID |
| PES1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| PHF5A | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| PIK3R1 | Affinity Capture-Western | physical | 16571724, (Europe PMC) | NA | BioGRID |
| PLOD2 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| PNPT1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| POLR1C | Affinity Capture-MS, Co-fractionation | physical | 26344197, 27049334, (Europe PMC) | NA | BioGRID |
| POLR2B | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| POU5F1 | Affinity Capture-Luminescence, Affinity Capture-RNA, proximity ligation assay | physical, physical association | 21048921, 21151833, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PPAN | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| PPP1CB | Affinity Capture-Western, anti bait coimmunoprecipitation, imaging technique | colocalization, physical, physical association | 12185196, (Europe PMC) | 0.46 | BioGRID, IntAct, MINT |
| PRKCZ | Biochemical Activity | physical | 9388266, (Europe PMC) | NA | BioGRID |
| PRMT1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| PRMT5 | Affinity Capture-Western | physical | 17974993, (Europe PMC) | NA | BioGRID |
| PRPF3 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| PRPF8 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| PSMA3 | Affinity Capture-MS | physical | 22079093, (Europe PMC) | NA | BioGRID |
| PTBP1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| PTGS1 | Affinity Capture-RNA, Protein-RNA | physical | 17320986, (Europe PMC) | NA | BioGRID |
| PTMA | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PTPRZ1 | Affinity Capture-Western | physical | 23161541, (Europe PMC) | NA | BioGRID |
| PUF60 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| PWP1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RANGAP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| RBM39 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RBM42 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RBM46 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| RC3H1 | Affinity Capture-MS | physical | 26170170, (Europe PMC) | NA | BioGRID |
| RCL1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RCN1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RDX | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RECQL5 | Affinity Capture-MS | physical | 19270065, (Europe PMC) | NA | BioGRID |
| RFC3 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RFXAP | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RNF146 | Affinity Capture-MS, Affinity Capture-Western | physical | 21825151, (Europe PMC) | NA | BioGRID |
| RNF168 | Affinity Capture-MS | physical | 27558965, (Europe PMC) | NA | BioGRID |
| RNF2 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| RPA1 | Affinity Capture-MS | physical | 24332808, (Europe PMC) | NA | BioGRID |
| RPA2 | Affinity Capture-MS | physical | 24332808, (Europe PMC) | NA | BioGRID |
| RPA3 | Affinity Capture-MS | physical | 24332808, (Europe PMC) | NA | BioGRID |
| RPF2 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPL11 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPL12 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPL13 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPL13A | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPL14 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPL15 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPL17 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPL18 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPL18A | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPL19 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPL21 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPL22 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPL23 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPL23A | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPL24 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPL26L1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| RPL27 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPL27A | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPL28 | Affinity Capture-MS | physical | 27049334, 28514442, (Europe PMC) | NA | BioGRID |
| RPL3 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 26344197, 27049334, (Europe PMC) | NA | BioGRID |
| RPL31 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPL35A | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPL36 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPL37A | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| RPL4 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPL5 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 26344197, 27049334, (Europe PMC) | NA | BioGRID |
| RPL6 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPL7 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 26344197, 27049334, (Europe PMC) | NA | BioGRID |
| RPL7A | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPL8 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPL9 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPLP0 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPLP1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPS10 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPS12 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPS13 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPS14 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPS15 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPS16 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPS17 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPS18 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPS19 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPS2 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPS20 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPS23 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPS24 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPS25 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPS26 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPS27 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPS3 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPS3A | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPS4X | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPS5 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPS6 | Affinity Capture-MS, Co-fractionation, proximity-dependent biotin identification | association, physical | 22939629, 27049334, 29568061, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPS6KB2 | Affinity Capture-MS | physical | 25324306, (Europe PMC) | NA | BioGRID |
| RPS7 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPS8 | Affinity Capture-MS, Co-fractionation | physical | 26344197, 27049334, (Europe PMC) | NA | BioGRID |
| RPS9 | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 17461779, 27049334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RRP1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RRP1B | Affinity Capture-MS, anti tag coimmunoprecipitation, confocal microscopy, tandem affinity purification | association, colocalization, physical | 19710015, 27049334, (Europe PMC) | 0.51 | BioGRID, IntAct |
| RRS1 | Affinity Capture-MS | physical | 27049334, 28514442, (Europe PMC) | NA | BioGRID |
| RSL1D1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| S100A11 | Affinity Capture-Western, Reconstituted Complex | physical | 14623863, (Europe PMC) | NA | BioGRID |
| SART1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| SCARNA22 | Affinity Capture-RNA | physical | 22751105, (Europe PMC) | NA | BioGRID |
| SEPT9 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SF3B4 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SIRT7 | Affinity Capture-MS | physical | 22586326, (Europe PMC) | NA | BioGRID |
| SKI | Affinity Capture-MS | physical | 25670202, (Europe PMC) | NA | BioGRID |
| SLC25A1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| SMARCA4 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| SMARCA5 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| SMC1A | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| SMC2 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| SMC3 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| SMURF1 | Affinity Capture-MS | physical | 23184937, (Europe PMC) | NA | BioGRID |
| SNRNP200 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| SNRPD1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| SNRPD2 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| SNRPN | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| SP1 | Affinity Capture-Western | physical | 14623863, (Europe PMC) | NA | BioGRID |
| SPART | Affinity Capture-MS, Affinity Capture-Western | physical | 19765186, (Europe PMC) | NA | BioGRID |
| SREK1 | Affinity Capture-MS | physical | 14559993, (Europe PMC) | NA | BioGRID |
| SRP14 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| SRPK1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| SRPK2 | Biochemical Activity | physical | 26167880, (Europe PMC) | NA | BioGRID |
| SRPK3 | Affinity Capture-MS, tandem affinity purification | association, physical | 23602568, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SRRM1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| SRSF3 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| SRSF5 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| SSB | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation | physical, physical association | 12096904, 18292223, (Europe PMC) | 0.40 | BioGRID, IntAct |
| STAU1 | Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology, imaging technique, tandem affinity purification | association, colocalization, physical | 15121898, 15303970, 23125841, (Europe PMC) | 0.58 | BioGRID, IntAct |
| SUPT4H1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| SUPT5H | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| SUPT6H | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| SUZ12 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| SWAP70 | Co-purification | physical | 9642267, (Europe PMC) | NA | BioGRID |
| TAF4 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TARDBP | Affinity Capture-MS | physical | 20020773, (Europe PMC) | NA | BioGRID |
| TERF2 | Two-hybrid, bimolecular fluorescence complementation | physical, physical association | 21044950, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TERT | Affinity Capture-Western, Reconstituted Complex | physical | 15371412, (Europe PMC) | NA | BioGRID |
| TOP1 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, pull down | association, direct interaction, physical | 15848144, 8567649, 9512561, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| TP53 | Affinity Capture-Western, Far Western, Reconstituted Complex, far western blotting, pull down | direct interaction, physical | 12138209, 22103682, 26238070, (Europe PMC) | 0.56 | BioGRID, IntAct, MINT |
| TRIM25 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| TSR1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| U2AF1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| U2AF2 | Affinity Capture-MS | physical | 26641092, 27049334, (Europe PMC) | NA | BioGRID |
| U2SURP | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| UBC | Affinity Capture-MS | physical | 16196087, (Europe PMC) | NA | BioGRID |
| UBE2A | Affinity Capture-MS | physical | 28031328, (Europe PMC) | NA | BioGRID |
| UBE2S | Affinity Capture-MS | physical | 27593939, (Europe PMC) | NA | BioGRID |
| UBL4A | Affinity Capture-MS | physical | 23246001, (Europe PMC) | NA | BioGRID |
| UNK | Affinity Capture-RNA | physical | 25737280, (Europe PMC) | NA | BioGRID |
| UQCRC2 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| USP39 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| USP7 | Affinity Capture-Western | physical | 25695607, 26238070, (Europe PMC) | NA | BioGRID |
| VCAM1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, 22623428, 23463506, (Europe PMC) | 0.35 | BioGRID, IntAct |
| VHL | Reconstituted Complex | physical | 22234250, (Europe PMC) | NA | BioGRID |
| WDR43 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| WDR46 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| XRCC5 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| XRCC6 | Reconstituted Complex | physical | 23145133, (Europe PMC) | NA | BioGRID |
| YAP1 | Affinity Capture-MS | physical | 25796446, (Europe PMC) | NA | BioGRID |
| YBX1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| YWHAQ | Reconstituted Complex | physical | 15161933, (Europe PMC) | NA | BioGRID |
| YY1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| ZBTB1 | Affinity Capture-MS | physical | 24657165, (Europe PMC) | NA | BioGRID |
| ZC3H15 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| ZC3HAV1 | Affinity Capture-MS, Affinity Capture-Western | physical | 27049334, (Europe PMC) | NA | BioGRID |
| ZFP36 | Two-hybrid | physical | 20221403, (Europe PMC) | NA | BioGRID |
| ZNF689 | Affinity Capture-MS, Affinity Capture-Western | physical | 16568080, (Europe PMC) | NA | BioGRID |
| ZNF746 | Affinity Capture-MS | physical | 25315684, (Europe PMC) | NA | BioGRID |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AGO1 | anti tag coimmunoprecipitation | association | 17932509, (Europe PMC) | 0.35 | IntAct, MINT |
| AKAP5 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ANKRD28 | anti bait coimmunoprecipitation | physical association | 17928403, (Europe PMC) | 0.40 | IntAct |
| APTX | fluorescence microscopy, pull down | association, colocalization | 15044383, (Europe PMC) | 0.43 | IntAct |
| ARFGEF1 | Affinity Capture-Western, anti bait coimmunoprecipitation | association, physical, physical association | 14973189, 18292223, (Europe PMC) | 0.50 | BioGRID, IntAct |
| ARRB1 | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical, physical association | 17620599, (Europe PMC) | 0.50 | BioGRID, IntAct |
| ARRB2 | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical, physical association | 17620599, (Europe PMC) | 0.50 | BioGRID, IntAct |
| BAG2 | tandem affinity purification | association | 18457437, (Europe PMC) | 0.35 | IntAct, MINT |
| BCAR1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CASP8 | imaging technique | colocalization | 17290218, (Europe PMC) | 0.27 | IntAct, MINT |
| CBX6 | Affinity Capture-MS, tandem affinity purification | association, physical | 21282530, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CBX8 | Affinity Capture-MS, tandem affinity purification | association, physical | 21282530, (Europe PMC) | 0.35 | BioGRID, IntAct |
| COL18A1 | anti bait coimmunoprecipitation, confocal microscopy, fluorescence technology, fluorescence-activated cell sorting, pull down, surface plasmon resonance | association, colocalization, direct interaction, physical association | 17615292, 19877579, (Europe PMC) | 0.78 | IntAct |
| CSNK2A1 | Biochemical Activity, Co-fractionation, protein kinase assay | phosphorylation reaction, physical | 22113938, 26344197, (Europe PMC) | 0.44 | BioGRID, IntAct |
| DDX41 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25920683, 27049334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DUX4 | pull down | association | 26816005, (Europe PMC) | 0.35 | IntAct |
| E2F3 | pull down | association | 22157815, (Europe PMC) | 0.35 | IntAct, MINT |
| EGFR | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation | association, physical | 24780295, 25261371, 28065597, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ESR1 | Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology, cosedimentation through density gradient | association, physical | 20348541, 21182205, (Europe PMC) | 0.46 | BioGRID, IntAct |
| ETS1 | Reconstituted Complex, display technology | physical, physical association | 20195357, (Europe PMC) | 0.40 | BioGRID, IntAct |
| EXOSC2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, 27049334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FBL | Affinity Capture-Western, anti bait coimmunoprecipitation | association, physical | 18292223, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FN1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FOS | display technology | physical association | 20195357, (Europe PMC) | 0.40 | IntAct |
| GABARAP | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GABARAPL1 | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GABARAPL2 | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GRB2 | Two-hybrid, pull down, two hybrid pooling approach | association, physical, physical association | 12577067, 20936779, (Europe PMC) | 0.55 | BioGRID, IntAct |
| HCK | pull down | physical association | 12029088, (Europe PMC) | 0.40 | IntAct, MINT |
| HDGF | Affinity Capture-MS, tandem affinity purification | association, physical | 21907836, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HMGA1 | Far Western, filter binding | association, physical | 18850631, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IFIT1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21642987, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IFIT3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21642987, (Europe PMC) | 0.35 | BioGRID, IntAct |
| JMJD6 | anti tag coimmunoprecipitation | association | 24498420, (Europe PMC) | 0.35 | IntAct |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| LARP7 | tandem affinity purification | association | 18281698, (Europe PMC) | 0.35 | IntAct |
| LRRK2 | anti tag coimmunoprecipitation, tandem affinity purification | association | 23075850, 24725412, (Europe PMC) | 0.53 | IntAct |
| LTF | surface plasmon resonance | direct interaction | 21575138, (Europe PMC) | 0.44 | IntAct, MINT |
| MAP1LC3A | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| MAP1LC3B | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| MAP3K1 | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| MAP3K14 | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| MAPK13 | anti tag coimmunoprecipitation | association | 19135240, (Europe PMC) | 0.35 | IntAct |
| MDM2 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, display technology, far western blotting, pull down | direct interaction, physical, physical association | 16751805, 20195357, 22103682, 24147044, (Europe PMC) | 0.71 | BioGRID, IntAct, MINT |
| MYC | Affinity Capture-MS, tandem affinity purification | association, physical | 17314511, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MYH9 | anti bait coimmunoprecipitation, confocal microscopy | colocalization, physical association | 16403913, (Europe PMC) | 0.46 | IntAct |
| NCL | Affinity Capture-Western, blue native page, surface plasmon resonance | direct interaction, physical | 21575138, 25313645, (Europe PMC) | 0.56 | BioGRID, IntAct, MINT |
| NDN | display technology | physical association | 20195357, (Europe PMC) | 0.40 | IntAct |
| NDRG1 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17220478, (Europe PMC) | 0.40 | BioGRID, IntAct |
| NFE4 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 19234465, 22689669, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NFKB2 | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| NFKBIB | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| NOP9 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NPM1 | Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, proximity ligation assay | physical, physical association | 16648475, 20431927, 21048921, 22362753, 22939629, 28514442, 8620867, (Europe PMC) | 0.40 | BioGRID, IntAct |
| NUP62 | Affinity Capture-Western, anti bait coimmunoprecipitation | association, physical | 14973189, 18292223, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NXF1 | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 18596238, 27049334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PA2G4 | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, pull down | association, physical, physical association | 15064750, 19037095, 19946338, (Europe PMC) | 0.50 | BioGRID, IntAct |
| PAX8 | display technology | physical association | 20195357, (Europe PMC) | 0.40 | IntAct |
| PCBD1 | display technology | physical association | 20195357, (Europe PMC) | 0.40 | IntAct |
| PITX2 | anti tag coimmunoprecipitation | association | 19174163, (Europe PMC) | 0.35 | IntAct, MINT |
| PLEKHA7 | anti bait coimmunoprecipitation | association | 28877994, (Europe PMC) | 0.35 | IntAct |
| POU5F1 | Affinity Capture-Luminescence, Affinity Capture-RNA, proximity ligation assay | physical, physical association | 21048921, 21151833, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PPP1CB | Affinity Capture-Western, anti bait coimmunoprecipitation, imaging technique | colocalization, physical, physical association | 12185196, (Europe PMC) | 0.46 | BioGRID, IntAct, MINT |
| PRKAR1A | display technology | physical association | 20195357, (Europe PMC) | 0.40 | IntAct |
| RAC3 | display technology | physical association | 20195357, (Europe PMC) | 0.40 | IntAct |
| RB1 | display technology | physical association | 20195357, (Europe PMC) | 0.40 | IntAct |
| RELA | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| RHOA | anti bait coimmunoprecipitation, fluorescence microscopy | colocalization, physical association | 21281639, (Europe PMC) | 0.46 | IntAct, MINT |
| ROCK1 | pull down | association | 21281639, (Europe PMC) | 0.35 | IntAct, MINT |
| ROCK2 | anti bait coimmunoprecipitation | physical association | 21281639, (Europe PMC) | 0.40 | IntAct, MINT |
| RPS6 | Affinity Capture-MS, Co-fractionation, proximity-dependent biotin identification | association, physical | 22939629, 27049334, 29568061, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPS9 | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 17461779, 27049334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RRP1B | Affinity Capture-MS, anti tag coimmunoprecipitation, confocal microscopy, tandem affinity purification | association, colocalization, physical | 19710015, 27049334, (Europe PMC) | 0.51 | BioGRID, IntAct |
| SERBP1 | fluorescence microscopy | colocalization | 24205981, (Europe PMC) | 0.27 | IntAct, MINT |
| SFPQ | anti tag coimmunoprecipitation | association | 20932480, (Europe PMC) | 0.35 | IntAct |
| SNW1 | anti bait coimmunoprecipitation | association | 20467437, (Europe PMC) | 0.35 | IntAct, MINT |
| SPART | anti bait coimmunoprecipitation, tandem affinity purification | association | 19765186, (Europe PMC) | 0.46 | IntAct |
| SRPK3 | Affinity Capture-MS, tandem affinity purification | association, physical | 23602568, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SRSF2 | anti bait coimmunoprecipitation, fluorescence microscopy | colocalization, physical association | 23353999, (Europe PMC) | 0.46 | IntAct, MINT |
| SSB | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation | physical, physical association | 12096904, 18292223, (Europe PMC) | 0.40 | BioGRID, IntAct |
| STAU1 | Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology, imaging technique, tandem affinity purification | association, colocalization, physical | 15121898, 15303970, 23125841, (Europe PMC) | 0.58 | BioGRID, IntAct |
| STK4 | tandem affinity purification | association | 23386615, (Europe PMC) | 0.35 | IntAct |
| TERF2 | Two-hybrid, bimolecular fluorescence complementation | physical, physical association | 21044950, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TOP1 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, pull down | association, direct interaction, physical | 15848144, 8567649, 9512561, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| TP53 | Affinity Capture-Western, Far Western, Reconstituted Complex, far western blotting, pull down | direct interaction, physical | 12138209, 22103682, 26238070, (Europe PMC) | 0.56 | BioGRID, IntAct, MINT |
| VCAM1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, 22623428, 23463506, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAZ | pull down | physical association | 15161933, (Europe PMC) | 0.40 | IntAct, MINT |
| ZC3H18 | anti tag coimmunoprecipitation | association | 29298432, (Europe PMC) | 0.35 | IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| BAG2 | tandem affinity purification | association | 18457437, (Europe PMC) | 0.35 | IntAct, MINT |
| CASP8 | imaging technique | colocalization | 17290218, (Europe PMC) | 0.27 | IntAct, MINT |
| E2F3 | pull down | association | 22157815, (Europe PMC) | 0.35 | IntAct, MINT |
| HCK | pull down | physical association | 12029088, (Europe PMC) | 0.40 | IntAct, MINT |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| LTF | surface plasmon resonance | direct interaction | 21575138, (Europe PMC) | 0.44 | IntAct, MINT |
| MDM2 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, display technology, far western blotting, pull down | direct interaction, physical, physical association | 16751805, 20195357, 22103682, 24147044, (Europe PMC) | 0.71 | BioGRID, IntAct, MINT |
| NCL | Affinity Capture-Western, blue native page, surface plasmon resonance | direct interaction, physical | 21575138, 25313645, (Europe PMC) | 0.56 | BioGRID, IntAct, MINT |
| PITX2 | anti tag coimmunoprecipitation | association | 19174163, (Europe PMC) | 0.35 | IntAct, MINT |
| PPP1CB | Affinity Capture-Western, anti bait coimmunoprecipitation, imaging technique | colocalization, physical, physical association | 12185196, (Europe PMC) | 0.46 | BioGRID, IntAct, MINT |
| RHOA | anti bait coimmunoprecipitation, fluorescence microscopy | colocalization, physical association | 21281639, (Europe PMC) | 0.46 | IntAct, MINT |
| ROCK1 | pull down | association | 21281639, (Europe PMC) | 0.35 | IntAct, MINT |
| ROCK2 | anti bait coimmunoprecipitation | physical association | 21281639, (Europe PMC) | 0.40 | IntAct, MINT |
| SERBP1 | fluorescence microscopy | colocalization | 24205981, (Europe PMC) | 0.27 | IntAct, MINT |
| SNW1 | anti bait coimmunoprecipitation | association | 20467437, (Europe PMC) | 0.35 | IntAct, MINT |
| SRSF2 | anti bait coimmunoprecipitation, fluorescence microscopy | colocalization, physical association | 23353999, (Europe PMC) | 0.46 | IntAct, MINT |
| TOP1 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, pull down | association, direct interaction, physical | 15848144, 8567649, 9512561, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| TP53 | Affinity Capture-Western, Far Western, Reconstituted Complex, far western blotting, pull down | direct interaction, physical | 12138209, 22103682, 26238070, (Europe PMC) | 0.56 | BioGRID, IntAct, MINT |
| YWHAZ | pull down | physical association | 15161933, (Europe PMC) | 0.40 | IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ACLY | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| ACTB | molecular sieving | physical association | 15047060, (Europe PMC) | 0.40 | IntAct |
| ACTL6A | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| ACTN4 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| ADAP1 | Affinity Capture-Western, Co-purification, Reconstituted Complex | physical | 12565890, 18298663, (Europe PMC) | NA | BioGRID |
| ADAP2 | Reconstituted Complex | physical | 18298663, (Europe PMC) | NA | BioGRID |
| AGO1 | anti tag coimmunoprecipitation | association | 17932509, (Europe PMC) | 0.35 | IntAct, MINT |
| AKAP5 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ALYREF | Affinity Capture-MS, Affinity Capture-Western | physical | 27049334, (Europe PMC) | NA | BioGRID |
| ANAPC1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ANAPC7 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ANKRD28 | anti bait coimmunoprecipitation | physical association | 17928403, (Europe PMC) | 0.40 | IntAct |
| ANP32B | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| APTX | fluorescence microscopy, pull down | association, colocalization | 15044383, (Europe PMC) | 0.43 | IntAct |
| ARFGEF1 | Affinity Capture-Western, anti bait coimmunoprecipitation | association, physical, physical association | 14973189, 18292223, (Europe PMC) | 0.50 | BioGRID, IntAct |
| ARRB1 | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical, physical association | 17620599, (Europe PMC) | 0.50 | BioGRID, IntAct |
| ARRB2 | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical, physical association | 17620599, (Europe PMC) | 0.50 | BioGRID, IntAct |
| AURKA | Affinity Capture-MS | physical | 23443559, (Europe PMC) | NA | BioGRID |
| BAG2 | tandem affinity purification | association | 18457437, (Europe PMC) | 0.35 | IntAct, MINT |
| BAG3 | Affinity Capture-MS | physical | 23824909, (Europe PMC) | NA | BioGRID |
| BCAR1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| BMI1 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| BRCA1 | Affinity Capture-MS | physical | 26831064, (Europe PMC) | NA | BioGRID |
| BRIX1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| C7orf50 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| CAND1 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CASP8 | imaging technique | colocalization | 17290218, (Europe PMC) | 0.27 | IntAct, MINT |
| CBX5 | Affinity Capture-MS | physical | 20850016, (Europe PMC) | NA | BioGRID |
| CBX6 | Affinity Capture-MS, tandem affinity purification | association, physical | 21282530, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CBX8 | Affinity Capture-MS, tandem affinity purification | association, physical | 21282530, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CCDC8 | Affinity Capture-MS | physical | 24711643, (Europe PMC) | NA | BioGRID |
| CD3E | Reconstituted Complex | physical | 11115514, (Europe PMC) | NA | BioGRID |
| CD3EAP | Reconstituted Complex | physical | 23145133, (Europe PMC) | NA | BioGRID |
| CD4 | Affinity Capture-MS | physical | 15047060, (Europe PMC) | NA | BioGRID |
| CD81 | Affinity Capture-MS, Affinity Capture-Western | physical | 23463506, (Europe PMC) | NA | BioGRID |
| CDC27 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| CDC5L | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| CDC73 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| CDK1 | Biochemical Activity | physical | 24530506, (Europe PMC) | NA | BioGRID |
| CDK11A | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| CDKN1A | Affinity Capture-MS | physical | 23443559, (Europe PMC) | NA | BioGRID |
| CDKN2A | Affinity Capture-Western | physical | 14636574, (Europe PMC) | NA | BioGRID |
| CEP170 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| CHCHD3 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| CHD4 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| CLK1 | Biochemical Activity | physical | 26167880, (Europe PMC) | NA | BioGRID |
| COL18A1 | anti bait coimmunoprecipitation, confocal microscopy, fluorescence technology, fluorescence-activated cell sorting, pull down, surface plasmon resonance | association, colocalization, direct interaction, physical association | 17615292, 19877579, (Europe PMC) | 0.78 | IntAct |
| COPS5 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| COPS6 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CRY2 | Affinity Capture-MS | physical | 25756610, (Europe PMC) | NA | BioGRID |
| CSNK2A1 | Biochemical Activity, Co-fractionation, protein kinase assay | phosphorylation reaction, physical | 22113938, 26344197, (Europe PMC) | 0.44 | BioGRID, IntAct |
| CSNK2A2 | Affinity Capture-Western, Biochemical Activity, Far Western | physical | 8663258, (Europe PMC) | NA | BioGRID |
| CTCF | Affinity Capture-Western | physical | 19450526, (Europe PMC) | NA | BioGRID |
| CUL1 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CUL2 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CUL3 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CUL4A | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CUL4B | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CUL5 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CUL7 | Affinity Capture-MS | physical | 24711643, (Europe PMC) | NA | BioGRID |
| CYFIP1 | Affinity Capture-Western | physical | 11438699, (Europe PMC) | NA | BioGRID |
| CYLD | Affinity Capture-MS | physical | 27591049, (Europe PMC) | NA | BioGRID |
| DAP3 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| DAXX | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| DCAF1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| DCAF4L2 | Affinity Capture-MS | physical | 27158335, (Europe PMC) | NA | BioGRID |
| DCUN1D1 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| DDX18 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| DDX21 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| DDX24 | Affinity Capture-Western | physical | 24980433, (Europe PMC) | NA | BioGRID |
| DDX41 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25920683, 27049334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DDX47 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| DDX50 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| DGCR8 | Affinity Capture-MS, Affinity Capture-Western | physical | 17765891, (Europe PMC) | NA | BioGRID |
| DHX15 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| DHX30 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| DHX9 | Affinity Capture-MS, Affinity Capture-Western | physical | 22751105, 27049334, (Europe PMC) | NA | BioGRID |
| DNM1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| DUX4 | pull down | association | 26816005, (Europe PMC) | 0.35 | IntAct |
| E2F3 | pull down | association | 22157815, (Europe PMC) | 0.35 | IntAct, MINT |
| EBNA1BP2 | Affinity Capture-MS, Co-fractionation | physical | 26344197, 27049334, 28514442, (Europe PMC) | NA | BioGRID |
| EED | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| EGFR | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation | association, physical | 24780295, 25261371, 28065597, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EIF3A | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| EIF3C | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| EIF3D | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| EIF3G | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| EIF3L | Co-fractionation | physical | 22939629, 26344197, (Europe PMC) | NA | BioGRID |
| EIF5B | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| EIF6 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| ELAVL1 | Affinity Capture-RNA | physical | 19322201, (Europe PMC) | NA | BioGRID |
| ERG | Affinity Capture-MS, Reconstituted Complex | physical | 24591637, (Europe PMC) | NA | BioGRID |
| ERH | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| ESR1 | Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology, cosedimentation through density gradient | association, physical | 20348541, 21182205, (Europe PMC) | 0.46 | BioGRID, IntAct |
| ETS1 | Reconstituted Complex, display technology | physical, physical association | 20195357, (Europe PMC) | 0.40 | BioGRID, IntAct |
| EXOSC10 | Affinity Capture-MS, Affinity Capture-Western | physical | 27049334, (Europe PMC) | NA | BioGRID |
| EXOSC2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, 27049334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EXOSC4 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| EXOSC9 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| EZH2 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| FBL | Affinity Capture-Western, anti bait coimmunoprecipitation | association, physical | 18292223, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FBXO25 | Affinity Capture-MS | physical | 20473970, (Europe PMC) | NA | BioGRID |
| FMR1 | Affinity Capture-Western | physical | 10567518, (Europe PMC) | NA | BioGRID |
| FN1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FOS | display technology | physical association | 20195357, (Europe PMC) | 0.40 | IntAct |
| FTSJ3 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| FYTTD1 | Affinity Capture-MS | physical | 19836239, (Europe PMC) | NA | BioGRID |
| GABARAP | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GABARAPL1 | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GABARAPL2 | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GAN | Affinity Capture-MS | physical | 26460568, (Europe PMC) | NA | BioGRID |
| GNL3 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| GRB2 | Two-hybrid, pull down, two hybrid pooling approach | association, physical, physical association | 12577067, 20936779, (Europe PMC) | 0.55 | BioGRID, IntAct |
| GRK5 | Affinity Capture-MS | physical | 22952844, (Europe PMC) | NA | BioGRID |
| GRWD1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| GTF2F1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| GTF3C1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| GTPBP4 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| GZF1 | Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex | physical | 17674968, (Europe PMC) | NA | BioGRID |
| H1FX | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| H2AFX | Reconstituted Complex | physical | 23145133, (Europe PMC) | NA | BioGRID |
| H3F3A | Affinity Capture-MS | physical | 17403666, (Europe PMC) | NA | BioGRID |
| HCK | pull down | physical association | 12029088, (Europe PMC) | 0.40 | IntAct, MINT |
| HDAC6 | Affinity Capture-MS | physical | 26643866, (Europe PMC) | NA | BioGRID |
| HDGF | Affinity Capture-MS, tandem affinity purification | association, physical | 21907836, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HDGFL2 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| HIST1H1C | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex | physical | 18258596, (Europe PMC) | NA | BioGRID |
| HIST2H2AC | Reconstituted Complex | physical | 16601700, (Europe PMC) | NA | BioGRID |
| HIST2H2BE | Reconstituted Complex | physical | 16601700, (Europe PMC) | NA | BioGRID |
| HIST2H3A | Affinity Capture-MS | physical | 29104064, (Europe PMC) | NA | BioGRID |
| HIST3H3 | Protein-peptide | physical | 20850016, (Europe PMC) | NA | BioGRID |
| HMGA1 | Far Western, filter binding | association, physical | 18850631, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HNRNPA1 | Affinity Capture-MS | physical | 25324306, (Europe PMC) | NA | BioGRID |
| HNRNPD | Affinity Capture-Western | physical | 16571724, (Europe PMC) | NA | BioGRID |
| HNRNPK | Co-fractionation | physical | 22863883, 26344197, (Europe PMC) | NA | BioGRID |
| HNRNPR | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| HNRNPU | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| HSP90AA1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| HUWE1 | Affinity Capture-MS | physical | 25147182, (Europe PMC) | NA | BioGRID |
| ICAM1 | Affinity Capture-MS, Affinity Capture-Western | physical | 23463506, (Europe PMC) | NA | BioGRID |
| IFIT1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21642987, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IFIT3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21642987, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IGF2BP1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| IGSF8 | Affinity Capture-MS, Affinity Capture-Western | physical | 23463506, (Europe PMC) | NA | BioGRID |
| IL7R | Protein-RNA | physical | 23151878, (Europe PMC) | NA | BioGRID |
| ILF2 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| ILF3 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| IRF2 | Affinity Capture-MS, Affinity Capture-Western | physical | 16582966, (Europe PMC) | NA | BioGRID |
| ITGA4 | Affinity Capture-MS | physical | 22623428, (Europe PMC) | NA | BioGRID |
| ITGAV | Affinity Capture-MS, Affinity Capture-Western | physical | 23161541, (Europe PMC) | NA | BioGRID |
| JMJD6 | anti tag coimmunoprecipitation | association | 24498420, (Europe PMC) | 0.35 | IntAct |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| KCTD12 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| KEAP1 | Affinity Capture-MS | physical | 27621311, (Europe PMC) | NA | BioGRID |
| KMT2A | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| KPNB1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| KRAS | Synthetic Lethality | genetic | 19490893, (Europe PMC) | NA | BioGRID |
| LARP7 | tandem affinity purification | association | 18281698, (Europe PMC) | 0.35 | IntAct |
| LASP1 | Affinity Capture-MS | physical | 25982273, (Europe PMC) | NA | BioGRID |
| LMNA | Affinity Capture-MS, Co-fractionation, Proximity Label-MS | physical | 22412018, 22863883, 25948554, (Europe PMC) | NA | BioGRID |
| LRRK2 | anti tag coimmunoprecipitation, tandem affinity purification | association | 23075850, 24725412, (Europe PMC) | 0.53 | IntAct |
| LTF | surface plasmon resonance | direct interaction | 21575138, (Europe PMC) | 0.44 | IntAct, MINT |
| LYAR | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| MAGED2 | Affinity Capture-Western | physical | 26705694, (Europe PMC) | NA | BioGRID |
| MAP1LC3A | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| MAP1LC3B | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| MAP3K1 | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| MAP3K14 | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| MAPK13 | anti tag coimmunoprecipitation | association | 19135240, (Europe PMC) | 0.35 | IntAct |
| MCM2 | Affinity Capture-MS, Co-fractionation | physical | 22863883, 25963833, (Europe PMC) | NA | BioGRID |
| MCM5 | Affinity Capture-MS | physical | 25963833, (Europe PMC) | NA | BioGRID |
| MDC1 | Reconstituted Complex | physical | 23145133, (Europe PMC) | NA | BioGRID |
| MDK | Reconstituted Complex | physical | 12147681, (Europe PMC) | NA | BioGRID |
| MDM2 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, display technology, far western blotting, pull down | direct interaction, physical, physical association | 16751805, 20195357, 22103682, 24147044, (Europe PMC) | 0.71 | BioGRID, IntAct, MINT |
| MGMT | Affinity Capture-MS | physical | 16226712, (Europe PMC) | NA | BioGRID |
| MOGS | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| MRPS26 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| MRPS34 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| MRPS7 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| MRTO4 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| MSH6 | Affinity Capture-MS, Affinity Capture-Western | physical | 27049334, (Europe PMC) | NA | BioGRID |
| MTF1 | Affinity Capture-MS | physical | 28416769, (Europe PMC) | NA | BioGRID |
| MTPAP | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| MTREX | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| MYB | Affinity Capture-Western | physical | 10660576, (Europe PMC) | NA | BioGRID |
| MYBBP1A | Affinity Capture-MS | physical | 21386990, 27049334, (Europe PMC) | NA | BioGRID |
| MYBL1 | Affinity Capture-Western, Far Western | physical | 10660576, (Europe PMC) | NA | BioGRID |
| MYC | Affinity Capture-MS, tandem affinity purification | association, physical | 17314511, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MYH9 | anti bait coimmunoprecipitation, confocal microscopy | colocalization, physical association | 16403913, (Europe PMC) | 0.46 | IntAct |
| NAP1L1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| NAP1L4 | Co-fractionation | physical | 22939629, 26344197, (Europe PMC) | NA | BioGRID |
| NBN | Reconstituted Complex | physical | 23145133, (Europe PMC) | NA | BioGRID |
| NCBP1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| NCL | Affinity Capture-Western, blue native page, surface plasmon resonance | direct interaction, physical | 21575138, 25313645, (Europe PMC) | 0.56 | BioGRID, IntAct, MINT |
| NDN | display technology | physical association | 20195357, (Europe PMC) | 0.40 | IntAct |
| NDRG1 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17220478, (Europe PMC) | 0.40 | BioGRID, IntAct |
| NEDD8 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| NFE4 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 19234465, 22689669, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NFKB2 | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| NFKBIB | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| NFX1 | Affinity Capture-MS | physical | 17267499, (Europe PMC) | NA | BioGRID |
| NOC4L | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| NOP53 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| NOP56 | Affinity Capture-MS | physical | 12777385, (Europe PMC) | NA | BioGRID |
| NOP9 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NPM1 | Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, proximity ligation assay | physical, physical association | 16648475, 20431927, 21048921, 22362753, 22939629, 28514442, 8620867, (Europe PMC) | 0.40 | BioGRID, IntAct |
| NPM3 | Co-fractionation | physical | 22362753, 22863883, 26344197, (Europe PMC) | NA | BioGRID |
| NR3C1 | Reconstituted Complex | physical | 11162542, (Europe PMC) | NA | BioGRID |
| NSUN2 | Affinity Capture-Western | physical | 17215513, (Europe PMC) | NA | BioGRID |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| NUP62 | Affinity Capture-Western, anti bait coimmunoprecipitation | association, physical | 14973189, 18292223, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NXF1 | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 18596238, 27049334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| OBSL1 | Affinity Capture-MS | physical | 24711643, (Europe PMC) | NA | BioGRID |
| OXCT1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| PA2G4 | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, pull down | association, physical, physical association | 15064750, 19037095, 19946338, (Europe PMC) | 0.50 | BioGRID, IntAct |
| PABPC1 | Affinity Capture-Western | physical | 20221403, (Europe PMC) | NA | BioGRID |
| PAN2 | Affinity Capture-MS | physical | 23398456, (Europe PMC) | NA | BioGRID |
| PAX8 | display technology | physical association | 20195357, (Europe PMC) | 0.40 | IntAct |
| PCBD1 | display technology | physical association | 20195357, (Europe PMC) | 0.40 | IntAct |
| PES1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| PHF5A | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| PIK3R1 | Affinity Capture-Western | physical | 16571724, (Europe PMC) | NA | BioGRID |
| PITX2 | anti tag coimmunoprecipitation | association | 19174163, (Europe PMC) | 0.35 | IntAct, MINT |
| PLEKHA7 | anti bait coimmunoprecipitation | association | 28877994, (Europe PMC) | 0.35 | IntAct |
| PLOD2 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| PNPT1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| POLR1C | Affinity Capture-MS, Co-fractionation | physical | 26344197, 27049334, (Europe PMC) | NA | BioGRID |
| POLR2B | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| POU5F1 | Affinity Capture-Luminescence, Affinity Capture-RNA, proximity ligation assay | physical, physical association | 21048921, 21151833, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PPAN | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| PPP1CB | Affinity Capture-Western, anti bait coimmunoprecipitation, imaging technique | colocalization, physical, physical association | 12185196, (Europe PMC) | 0.46 | BioGRID, IntAct, MINT |
| PRKAR1A | display technology | physical association | 20195357, (Europe PMC) | 0.40 | IntAct |
| PRKCZ | Biochemical Activity | physical | 9388266, (Europe PMC) | NA | BioGRID |
| PRMT1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| PRMT5 | Affinity Capture-Western | physical | 17974993, (Europe PMC) | NA | BioGRID |
| PRPF3 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| PRPF8 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| PSMA3 | Affinity Capture-MS | physical | 22079093, (Europe PMC) | NA | BioGRID |
| PTBP1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| PTGS1 | Affinity Capture-RNA, Protein-RNA | physical | 17320986, (Europe PMC) | NA | BioGRID |
| PTMA | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PTPRZ1 | Affinity Capture-Western | physical | 23161541, (Europe PMC) | NA | BioGRID |
| PUF60 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| PWP1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RAC3 | display technology | physical association | 20195357, (Europe PMC) | 0.40 | IntAct |
| RANGAP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| RB1 | display technology | physical association | 20195357, (Europe PMC) | 0.40 | IntAct |
| RBM39 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RBM42 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RBM46 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| RC3H1 | Affinity Capture-MS | physical | 26170170, (Europe PMC) | NA | BioGRID |
| RCL1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RCN1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RDX | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RECQL5 | Affinity Capture-MS | physical | 19270065, (Europe PMC) | NA | BioGRID |
| RELA | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| RFC3 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RFXAP | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RHOA | anti bait coimmunoprecipitation, fluorescence microscopy | colocalization, physical association | 21281639, (Europe PMC) | 0.46 | IntAct, MINT |
| RNF146 | Affinity Capture-MS, Affinity Capture-Western | physical | 21825151, (Europe PMC) | NA | BioGRID |
| RNF168 | Affinity Capture-MS | physical | 27558965, (Europe PMC) | NA | BioGRID |
| RNF2 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| ROCK1 | pull down | association | 21281639, (Europe PMC) | 0.35 | IntAct, MINT |
| ROCK2 | anti bait coimmunoprecipitation | physical association | 21281639, (Europe PMC) | 0.40 | IntAct, MINT |
| RPA1 | Affinity Capture-MS | physical | 24332808, (Europe PMC) | NA | BioGRID |
| RPA2 | Affinity Capture-MS | physical | 24332808, (Europe PMC) | NA | BioGRID |
| RPA3 | Affinity Capture-MS | physical | 24332808, (Europe PMC) | NA | BioGRID |
| RPF2 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPL11 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPL12 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPL13 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPL13A | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPL14 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPL15 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPL17 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPL18 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPL18A | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPL19 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPL21 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPL22 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPL23 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPL23A | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPL24 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPL26L1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| RPL27 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPL27A | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPL28 | Affinity Capture-MS | physical | 27049334, 28514442, (Europe PMC) | NA | BioGRID |
| RPL3 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 26344197, 27049334, (Europe PMC) | NA | BioGRID |
| RPL31 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPL35A | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPL36 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPL37A | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| RPL4 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPL5 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 26344197, 27049334, (Europe PMC) | NA | BioGRID |
| RPL6 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPL7 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 26344197, 27049334, (Europe PMC) | NA | BioGRID |
| RPL7A | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPL8 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPL9 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPLP0 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPLP1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPS10 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPS12 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPS13 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPS14 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPS15 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPS16 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPS17 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPS18 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPS19 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPS2 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPS20 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPS23 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPS24 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPS25 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPS26 | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPS27 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPS3 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPS3A | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPS4X | Affinity Capture-MS, Co-fractionation | physical | 22939629, 27049334, (Europe PMC) | NA | BioGRID |
| RPS5 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPS6 | Affinity Capture-MS, Co-fractionation, proximity-dependent biotin identification | association, physical | 22939629, 27049334, 29568061, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPS6KB2 | Affinity Capture-MS | physical | 25324306, (Europe PMC) | NA | BioGRID |
| RPS7 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RPS8 | Affinity Capture-MS, Co-fractionation | physical | 26344197, 27049334, (Europe PMC) | NA | BioGRID |
| RPS9 | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 17461779, 27049334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RRP1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| RRP1B | Affinity Capture-MS, anti tag coimmunoprecipitation, confocal microscopy, tandem affinity purification | association, colocalization, physical | 19710015, 27049334, (Europe PMC) | 0.51 | BioGRID, IntAct |
| RRS1 | Affinity Capture-MS | physical | 27049334, 28514442, (Europe PMC) | NA | BioGRID |
| RSL1D1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| S100A11 | Affinity Capture-Western, Reconstituted Complex | physical | 14623863, (Europe PMC) | NA | BioGRID |
| SART1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| SCARNA22 | Affinity Capture-RNA | physical | 22751105, (Europe PMC) | NA | BioGRID |
| SEPT9 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SERBP1 | fluorescence microscopy | colocalization | 24205981, (Europe PMC) | 0.27 | IntAct, MINT |
| SF3B4 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SFPQ | anti tag coimmunoprecipitation | association | 20932480, (Europe PMC) | 0.35 | IntAct |
| SIRT7 | Affinity Capture-MS | physical | 22586326, (Europe PMC) | NA | BioGRID |
| SKI | Affinity Capture-MS | physical | 25670202, (Europe PMC) | NA | BioGRID |
| SLC25A1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| SMARCA4 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| SMARCA5 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| SMC1A | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| SMC2 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| SMC3 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| SMURF1 | Affinity Capture-MS | physical | 23184937, (Europe PMC) | NA | BioGRID |
| SNRNP200 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| SNRPD1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| SNRPD2 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| SNRPN | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| SNW1 | anti bait coimmunoprecipitation | association | 20467437, (Europe PMC) | 0.35 | IntAct, MINT |
| SP1 | Affinity Capture-Western | physical | 14623863, (Europe PMC) | NA | BioGRID |
| SPART | Affinity Capture-MS, Affinity Capture-Western | physical | 19765186, (Europe PMC) | NA | BioGRID |
| SPART | anti bait coimmunoprecipitation, tandem affinity purification | association | 19765186, (Europe PMC) | 0.46 | IntAct |
| SREK1 | Affinity Capture-MS | physical | 14559993, (Europe PMC) | NA | BioGRID |
| SRP14 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| SRPK1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| SRPK2 | Biochemical Activity | physical | 26167880, (Europe PMC) | NA | BioGRID |
| SRPK3 | Affinity Capture-MS, tandem affinity purification | association, physical | 23602568, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SRRM1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| SRSF2 | anti bait coimmunoprecipitation, fluorescence microscopy | colocalization, physical association | 23353999, (Europe PMC) | 0.46 | IntAct, MINT |
| SRSF3 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| SRSF5 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| SSB | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation | physical, physical association | 12096904, 18292223, (Europe PMC) | 0.40 | BioGRID, IntAct |
| STAU1 | Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology, imaging technique, tandem affinity purification | association, colocalization, physical | 15121898, 15303970, 23125841, (Europe PMC) | 0.58 | BioGRID, IntAct |
| STK4 | tandem affinity purification | association | 23386615, (Europe PMC) | 0.35 | IntAct |
| SUPT4H1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| SUPT5H | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| SUPT6H | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| SUZ12 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| SWAP70 | Co-purification | physical | 9642267, (Europe PMC) | NA | BioGRID |
| TAF4 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TARDBP | Affinity Capture-MS | physical | 20020773, (Europe PMC) | NA | BioGRID |
| TERF2 | Two-hybrid, bimolecular fluorescence complementation | physical, physical association | 21044950, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TERT | Affinity Capture-Western, Reconstituted Complex | physical | 15371412, (Europe PMC) | NA | BioGRID |
| TOP1 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, pull down | association, direct interaction, physical | 15848144, 8567649, 9512561, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| TP53 | Affinity Capture-Western, Far Western, Reconstituted Complex, far western blotting, pull down | direct interaction, physical | 12138209, 22103682, 26238070, (Europe PMC) | 0.56 | BioGRID, IntAct, MINT |
| TRIM25 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| TSR1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| U2AF1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| U2AF2 | Affinity Capture-MS | physical | 26641092, 27049334, (Europe PMC) | NA | BioGRID |
| U2SURP | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| UBC | Affinity Capture-MS | physical | 16196087, (Europe PMC) | NA | BioGRID |
| UBE2A | Affinity Capture-MS | physical | 28031328, (Europe PMC) | NA | BioGRID |
| UBE2S | Affinity Capture-MS | physical | 27593939, (Europe PMC) | NA | BioGRID |
| UBL4A | Affinity Capture-MS | physical | 23246001, (Europe PMC) | NA | BioGRID |
| UNK | Affinity Capture-RNA | physical | 25737280, (Europe PMC) | NA | BioGRID |
| UQCRC2 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| USP39 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| USP7 | Affinity Capture-Western | physical | 25695607, 26238070, (Europe PMC) | NA | BioGRID |
| VCAM1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, 22623428, 23463506, (Europe PMC) | 0.35 | BioGRID, IntAct |
| VHL | Reconstituted Complex | physical | 22234250, (Europe PMC) | NA | BioGRID |
| WDR43 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| WDR46 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| XRCC5 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| XRCC6 | Reconstituted Complex | physical | 23145133, (Europe PMC) | NA | BioGRID |
| YAP1 | Affinity Capture-MS | physical | 25796446, (Europe PMC) | NA | BioGRID |
| YBX1 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| YWHAQ | Reconstituted Complex | physical | 15161933, (Europe PMC) | NA | BioGRID |
| YWHAZ | pull down | physical association | 15161933, (Europe PMC) | 0.40 | IntAct, MINT |
| YY1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| ZBTB1 | Affinity Capture-MS | physical | 24657165, (Europe PMC) | NA | BioGRID |
| ZC3H15 | Affinity Capture-MS | physical | 27049334, (Europe PMC) | NA | BioGRID |
| ZC3H18 | anti tag coimmunoprecipitation | association | 29298432, (Europe PMC) | 0.35 | IntAct |
| ZC3HAV1 | Affinity Capture-MS, Affinity Capture-Western | physical | 27049334, (Europe PMC) | NA | BioGRID |
| ZFP36 | Two-hybrid | physical | 20221403, (Europe PMC) | NA | BioGRID |
| ZNF689 | Affinity Capture-MS, Affinity Capture-Western | physical | 16568080, (Europe PMC) | NA | BioGRID |
| ZNF746 | Affinity Capture-MS | physical | 25315684, (Europe PMC) | NA | BioGRID |