Top  
 
 
MPZL1 
Localization (UniProt annotation) Membrane  Function (UniProt annotation) Cell surface receptor, which is involved in signaltransduction processes Recruits PTPN11/SHP-2 to the cell membraneand is a putative substrate of PTPN11/SHP-2 Is a major receptorfor concanavalin-A (ConA) and is involved in cellular signalinginduced by ConA, which probably includes Src family tyrosine-protein kinases Isoform 3 seems to have a dominant negative role;it blocks tyrosine phosphorylation of MPZL1 induced by ConAIsoform 1, but not isoform 2 and isoform 3, may be involved inregulation of integrin-mediated cell motility Catalytic Activity (UniProt annotation) N/A Protein Sequence MAASAGAGAVIAAPDSRRWLWSVLAAALGLLTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEG
ADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENL
PVFPVWVVVGIVTAVVLGLTLLISMILAVLYRRKNSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVI
YAQLDHSGGHHSDKINKSESVVYADIRKN 
ELM Motif Motif Instance  
  Description Motif Regex NA NA NA NA 
MPZL1 is dephosphorylated by following phosphatases:
Pathway ID  Pathway Name  Pathway Description (KEGG) hsa04514 Cell adhesion molecules (CAMs) Cell adhesion molecules are (glyco)proteins expressed on the cell surface and play a critical role in a wide array of biologic processes that include hemostasis, the immune response, inflammation, embryogenesis, and development of neuronal tissue. There are four main groups: the integrin family, the immunoglobulin superfamily, selectins, and cadherins. Membrane proteins that mediate immune cell–cell interactions fall into different categories, namely those involved in antigen recognition, costimulation and cellular adhesion. Furthermore cell-cell adhesions are important for brain morphology and highly coordinated brain functions such as memory and learning. During early development of the nervous system, neurons elongate their axons towards their targets and establish and maintain synapses through formation of cell-cell adhesions. Cell-cell adhesions also underpin axon-axon contacts and link neurons with supporting schwann cells and oligodendrocytes. 
 Visualize     Download 
 
Interacting partner Detection method Interaction type  PubMed IDs  Interaction Score  Source  ALDH1A2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID BAIAP2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CBWD1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CCDC8 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID CDH1 Proximity Label-MS physical 25468996 , (Europe PMC )NA BioGRID CPA2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CPA5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CRKL Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CTDSPL Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID CYP2S1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID DOK7 Two-hybrid physical 25814554 , (Europe PMC )NA BioGRID ELAVL1 Affinity Capture-RNA physical 19322201 , (Europe PMC )NA BioGRID EXOSC4 Two-hybrid physical 15231747 , (Europe PMC )NA BioGRID FCGRT Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FHL3 Two-hybrid physical 25416956 , (Europe PMC )NA BioGRID FTO Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GGT7 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HCCS Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID HSPA8 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IFIH1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IPPK Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID KIF7 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct LGALS3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LGALS9 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LIPF Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MED21 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MYO5C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NOXRED1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID POLA2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PTPN11 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, coimmunoprecipitation association, physical, physical association 10681522 , 28514442 , 9792637 , (Europe PMC )0.56 BioGRID, IntAct, MINT SFTPC Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SIGLECL1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SLC39A4 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SPACA1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SRC Affinity Capture-Western physical 11751924 , (Europe PMC )NA BioGRID STAT3 Two-hybrid physical 25814554 , (Europe PMC )NA BioGRID TENT4B Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID TMEM17 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct TMEM206 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TMEM30B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TMEM65 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TMPRSS11B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TRPC4AP Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID VAC14 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID VIPR1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID 
 Visualize     Download 
 
Interacting partner Detection method Interaction type  PubMed IDs  Interaction Score  Source  BAIAP2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CRKL Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct KIF7 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO5C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PTPN11 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, coimmunoprecipitation association, physical, physical association 10681522 , 28514442 , 9792637 , (Europe PMC )0.56 BioGRID, IntAct, MINT TMEM17 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct 
 Visualize     Download 
 
Interacting partner Detection method Interaction type  PubMed IDs  Interaction Score  Source  ACTBL2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ALDH1A2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID BAIAP2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CBWD1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CCDC8 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID CDH1 Proximity Label-MS physical 25468996 , (Europe PMC )NA BioGRID CPA2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CPA5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CRKL Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CTDSPL Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID CYP2S1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID DOK7 Two-hybrid physical 25814554 , (Europe PMC )NA BioGRID ELAVL1 Affinity Capture-RNA physical 19322201 , (Europe PMC )NA BioGRID EXOSC4 Two-hybrid physical 15231747 , (Europe PMC )NA BioGRID FCGRT Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FHL3 Two-hybrid physical 25416956 , (Europe PMC )NA BioGRID FTO Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GGT7 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HCCS Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID HSPA8 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IFIH1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IPPK Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID KIF7 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct LGALS3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LGALS9 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LIPF Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MED21 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MYO5C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NOXRED1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID POLA2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PTPN11 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, coimmunoprecipitation association, physical, physical association 10681522 , 28514442 , 9792637 , (Europe PMC )0.56 BioGRID, IntAct, MINT SFTPC Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SIGLECL1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SLC39A4 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SPACA1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SRC Affinity Capture-Western physical 11751924 , (Europe PMC )NA BioGRID STAT3 Two-hybrid physical 25814554 , (Europe PMC )NA BioGRID TENT4B Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID TMEM17 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct TMEM206 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TMEM30B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TMEM65 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TMPRSS11B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TRPC4AP Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID VAC14 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID VIPR1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID 
Phosphorylating Kinases Phosphoresidues Detection Method  PubMed IDs  Source  
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively 
SRC Y241_SHQGPVIyAQLDHSG , Y263_NKSESVVyADIRKN , LTP, in vitro, in vivo 10681522 , 11751924 , 17016520 , 18578522 , 18669648 , 18707149 , 19664994 , 20068231 ,(Europe PMC )HPRD, PhosphoELM , PhosphoSitePlus ,  Unknown S16_AVIAAPDsRRWLWSV , S204_KRDYTGCsTSESLSP , S206_DYTGCSTsESLSPVK , S208_TGCSTSEsLSPVKQA , S210_CSTSESLsPVKQAPR , S219_VKQAPRKsPSDTEGL , S221_QAPRKSPsDTEGLVK , S258_HSDKINKsESVVYAD , S260_DKINKSEsVVYADIR , T205_RDYTGCStSESLSPV , T223_PRKSPSDtEGLVKSL , Y200_RKNSKRDyTGCSTSE , Y241_SHQGPVIyAQLDHSG , Y263_NKSESVVyADIRKN , HTP, LTP, in vivo 10681522 , 17081983 , 17322306 , 17924679 , 18083107 , 18578522 , 18669648 , 18691976 , 18767875 , 19413330 , 19651622 , 19664994 , 20068231 , 20166139 , 9792637 ,(Europe PMC )HPRD, PhosphoELM ,