- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
HSPB1
Gene Name  | HSPB1 (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: 3Q9Q |
| Synonyms | HSPB1, HSP27, HSP28 | |
| Protein Name | HSPB1 | |
| Alternative Name(s) | Heat shock protein beta-1;HspB1;28 kDa heat shock protein;Estrogen-regulated 24 kDa protein;Heat shock 27 kDa protein;HSP 27;Stress-responsive protein 27;SRP27; | |
| Protein Family | Belongs to the small heat shock protein (HSP20)family | |
| EntrezGene ID | 3315 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P04792 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 22783 Dalton | |
| Protein Length | 205 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000106211 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - KOG3591 | eggNOG - ENOG410YERS | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm Nucleus Cytoplasm, cytoskeleton, spindle Note=Cytoplasmic in interphasecells Colocalizes with mitotic spindles in mitotic cellsTranslocates to the nucleus during heat shock and resides in sub-nuclear structures known as SC35 speckles or nuclear splicingspeckles | |||
| Function (UniProt annotation) | |||
| Small heat shock protein which functions as a molecularchaperone probably maintaining denatured proteins in a folding-competent state (PubMed:10383393, PubMed:20178975) Plays a rolein stress resistance and actin organization (PubMed:19166925)Through its molecular chaperone activity may regulate numerousbiological processes including the phosphorylation and the axonaltransport of neurofilament proteins (PubMed:23728742) | |||
| Catalytic Activity (UniProt annotation) | |||
| N/A | |||
| Protein Sequence | |||
| MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQ LSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPE GTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000502 | C:proteasome complex |
| GO:0001895 | P:retina homeostasis |
| GO:0001932 | P:regulation of protein phosphorylation |
| GO:0003723 | F:RNA binding |
| GO:0005080 | F:protein kinase C binding |
| GO:0005615 | C:extracellular space |
| GO:0005634 | C:nucleus |
| GO:0005737 | C:cytoplasm |
| GO:0005819 | C:spindle |
| GO:0005829 | C:cytosol |
| GO:0005856 | C:cytoskeleton |
| GO:0005886 | C:plasma membrane |
| GO:0005925 | C:focal adhesion |
| GO:0006446 | P:regulation of translational initiation |
| GO:0006469 | P:negative regulation of protein kinase activity |
| GO:0006986 | P:response to unfolded protein |
| GO:0008426 | F:protein kinase C inhibitor activity |
| GO:0009615 | P:response to virus |
| GO:0010506 | P:regulation of autophagy |
| GO:0019901 | F:protein kinase binding |
| GO:0030018 | C:Z disc |
| GO:0032731 | P:positive regulation of interleukin-1 beta production |
| GO:0035556 | P:intracellular signal transduction |
| GO:0035924 | P:cellular response to vascular endothelial growth factor stimulus |
| GO:0038033 | P:positive regulation of endothelial cell chemotaxis by VEGF-activated vascular endothelial growth factor receptor signaling pathway |
| GO:0042535 | P:positive regulation of tumor necrosis factor biosynthetic process |
| GO:0042802 | F:identical protein binding |
| GO:0042803 | F:protein homodimerization activity |
| GO:0043066 | P:negative regulation of apoptotic process |
| GO:0043122 | P:regulation of I-kappaB kinase/NF-kappaB signaling |
| GO:0043130 | F:ubiquitin binding |
| GO:0043488 | P:regulation of mRNA stability |
| GO:0043536 | P:positive regulation of blood vessel endothelial cell migration |
| GO:0044183 | F:protein binding involved in protein folding |
| GO:0045766 | P:positive regulation of angiogenesis |
| GO:0061077 | P:chaperone-mediated protein folding |
| GO:0070062 | C:extracellular exosome |
| GO:0070527 | P:platelet aggregation |
| GO:0099641 | P:anterograde axonal protein transport |
| GO:1902176 | P:negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway |
| GO:1904115 | C:axon cytoplasm |
| GO:2001028 | P:positive regulation of endothelial cell chemotaxis |
HSPB1 is dephosphorylated by following phosphatases:
| Phosphatase Gene Name | Phosphatase UniProt_AC | DephosphoSite and sequence (+/-5) in HSPB1 (P04792) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| PPP2CA | P67775 | NA | In vitro and in vivo | 7510704, | Europe PMC |  |
| PPP2CB | P62714 | NA | In vitro and in vivo | 7510704, | Europe PMC | |
| PPP3CA | Q08209 | NA | In vitro | 7510704, | Europe PMC | |
| PPP3CB | P16298 | NA | In vitro | 7510704, | Europe PMC | |
| PPP3CC | P48454 | NA | In vitro | 7510704, | Europe PMC | |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| hsa04010 | MAPK signaling pathway | The mitogen-activated protein kinase (MAPK) cascade is a highly conserved module that is involved in various cellular functions, including cell proliferation, differentiation and migration. Mammals express at least four distinctly regulated groups of MAPKs, extracellular signal-related kinases (ERK)-1/2, Jun amino-terminal kinases (JNK1/2/3), p38 proteins (p38alpha/beta/gamma/delta) and ERK5, that are activated by specific MAPKKs: MEK1/2 for ERK1/2, MKK3/6 for the p38, MKK4/7 (JNKK1/2) for the JNKs, and MEK5 for ERK5. Each MAPKK, however, can be activated by more than one MAPKKK, increasing the complexity and diversity of MAPK signalling. Presumably each MAPKKK confers responsiveness to distinct stimuli. For example, activation of ERK1/2 by growth factors depends on the MAPKKK c-Raf, but other MAPKKKs may activate ERK1/2 in response to pro-inflammatory stimuli. |
| hsa04370 | VEGF signaling pathway | There is now much evidence that VEGFR-2 is the major mediator of VEGF-driven responses in endothelial cells and it is considered to be a crucial signal transducer in both physiologic and pathologic angiogenesis. The binding of VEGF to VEGFR-2 leads to a cascade of different signaling pathways, resulting in the up-regulation of genes involved in mediating the proliferation and migration of endothelial cells and promoting their survival and vascular permeability. For example, the binding of VEGF to VEGFR-2 leads to dimerization of the receptor, followed by intracellular activation of the PLCgamma;PKC-Raf kinase-MEK-mitogen-activated protein kinase (MAPK) pathway and subsequent initiation of DNA synthesis and cell growth, whereas activation of the phosphatidylinositol 3' -kinase (PI3K)-Akt pathway leads to increased endothelial-cell survival. Activation of PI3K, FAK, and p38 MAPK is implicated in cell migration signaling. |
| hsa05146 | Amoebiasis | Entamoeba histolytica, an extracellular protozoan parasite is a human pathogen that invades the intestinal epithelium. Infection occurs on ingestion of contaminated water and food. The pathogenesis of amoebiasis begins with parasite attachment and disruption of the intestinal mucus layer, followed by apoptosis of host epithelial cells. Intestinal tissue destruction causes severe dysentery and ulcerations in amoebic colitis. Several amoebic proteins such as lectins, cysteine proteineases, and amoebapores are associated with the invasion process. The parasite can cause extraintestinal infection like amoebic liver abscess by evading immune response. |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-4420097 | VEGFA-VEGFR2 Pathway. | Angiogenesis is the formation of new blood vessels from preexisting vasculature. One of the most important proangiogenic factors is vascular endothelial growth factor (VEGF). VEGF exerts its biologic effect through interaction with transmembrane tyrosine kinase receptors VEGFR, selectively expressed on vascular endothelial cells. VEGFA signaling through VEGFR2 is the major pathway that activates angiogenesis by inducing the proliferation, survival, sprouting and migration of endothelial cells (ECs), and also by increasing endothelial permeability (Lohela et al. 2009, Shibuya & Claesson-Welsh 2006, Claesson-Welsh & Welsh, 2013). The critical role of VEGFR2 in vascular development is highlighted by the fact that VEGFR2-/- mice die at E8.5-9.5 due to defective development of blood islands, endothelial cells and haematopoietic cells (Shalaby et al. 1995) |
| R-HSA-450408 | AUF1 (hnRNP D0) binds and destabilizes mRNA. | AUF1 (hnRNP D0) dimers bind U-rich regions of AU-rich elements (AREs) in the 3' untranslated regions of mRNAs. The binding causes AUF1 dimers to assemble into higher order tetrameric complexes. Diphosphorylated AUF1 bound to RNA recruits additional proteins, including eIF4G, polyA-binding protein, Hsp, Hsc70, Hsp27, NSEP-1, NSAP-1, and IMP-2 which target the mRNA and AUF1 for degradation. Unphosphorylated AUF1 is thought to be less able to recruit additional proteins. AUF1 also interacts directly or indirectly with HuR and the RNA-induced silencing complex (RISC).AUF1 complexed with RNA and other proteins is ubiquitinated and targeted for destruction by the proteasome while the bound mRNA is degraded. Inhibition of ubiquitin addition to AUF1 blocks mRNA degradation. The mechanism by which ubiquitin-dependent proteolysis is coupled to mRNA degradation is unknown.At least 4 isoforms of AUF1 exist: p45 (45 kDa) contains all exons, p42 lacks exon 2, p40 lacks exon 7, and p37 lacks exons 2 and 7. The presence of exon 7 in p42 and p45 seems to block ubiquitination while the absence of exon 7 (p37 and p40) targets AUF1 for ubiquitination and destabilizes bound RNAs. Lack of exon 2 (p37 and p42) is associated with higher affinity for RNA and 14-3-3sigma (SFN).AUF1 binds and destabilizes mRNAs encoding Interleukin-1 beta (IL1B), Tumor Necrosis Factor alpha (TNFA), Cyclin-dependent kinase inhibitor 1 (CDNK1A, p21), Cyclin-D1 (CCND1), Granulocyte-macrophage colony stimulating factor (GM-CSF, CSF2), inducible Nitric oxide synthase (iNOS, NOS2), Proto-oncogene cFos (FOS), Myc proto-oncogene (MYC), Apoptosis regulator Bcl-2 (BCL2) |
| R-HSA-5687128 | MAPK6/MAPK4 signaling. | MAPK6 and MAPK4 (also known as ERK3 and ERK4) are vertebrate-specific atypical MAP kinases. Atypical MAPK are less well characterized than their conventional counterparts, and are generally classified as such based on their lack of activation by MAPKK family members. Unlike the conventional MAPK proteins, which contain a Thr-X-Tyr motif in the activation loop, MAPK6 and 4 have a single Ser-Glu-Gly phospho-acceptor motif (reviewed in Coulombe and Meloche, 2007; Cargnello et al, 2011). MAPK6 is also distinct in being an unstable kinase, whose turnover is mediated by ubiquitin-dependent degradation (Coulombe et al, 2003; Coulombe et al, 2004). The biological functions and pathways governing MAPK6 and 4 are not well established. MAPK6 and 4 are phosphorylated downstream of class I p21 activated kinases (PAKs) in a RAC- or CDC42-dependent manner (Deleris et al, 2008; Perander et al, 2008; Deleris et al, 2011; De La Mota-Peynado et al, 2011). One of the only well established substrates of MAPK6 and 4 is MAPKAPK5, which contributes to cell motility by promoting the HSBP1-dependent rearrangement of F-actin (Gerits et al, 2007; Kostenko et al, 2009a; reviewed in Kostenko et al, 2011b). The atypical MAPKs also contribute to cell motility and invasiveness through the NCOA3:ETV4-dependent regulation of MMP gene expression (Long et al, 2012; Yan et al, 2008; Qin et al, 2008) |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AATK | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ACAP2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ACBD6 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ACTN1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ACTN2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ACTN4 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| ADCY9 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ADD3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ADPRHL2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| AGAP10P | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| AGAP3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| AGAP4 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| AGAP5 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| AGAP7P | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| AHCY | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| AHNAK | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| AKT1 | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, proximity ligation assay | physical, physical association | 11042204, 12740362, 17510053, 23397142, (Europe PMC) | 0.40 | BioGRID, IntAct |
| ALPI | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| AMD1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ANAPC7 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ANK1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ANKRD7 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ANXA1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| AP2B1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ARAF | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ARHGAP28 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ARHGDIA | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ARHGEF7 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ARIH1 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| ARMC6 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ARMT1 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| ARRDC5 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ASB10 | Affinity Capture-MS | physical | 24337577, (Europe PMC) | NA | BioGRID |
| ASB17 | Affinity Capture-MS | physical | 24337577, (Europe PMC) | NA | BioGRID |
| ASB4 | Affinity Capture-MS | physical | 24337577, (Europe PMC) | NA | BioGRID |
| ASB6 | Affinity Capture-MS | physical | 24337577, (Europe PMC) | NA | BioGRID |
| ATF2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 22304920, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ATIC | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ATXN10 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| BAG3 | Affinity Capture-Luminescence, Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping, reverse ras recruitment system | association, physical, physical association | 25036637, 25277244, 26496610, (Europe PMC) | 0.72 | BioGRID, IntAct |
| BICDL1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| BRCA1 | Affinity Capture-MS | physical | 26831064, (Europe PMC) | NA | BioGRID |
| BTRC | Affinity Capture-MS | physical | 25900982, (Europe PMC) | NA | BioGRID |
| BUB1B | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| BVES | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| C11orf98 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| C12orf10 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| C2orf73 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CALR | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| CAMK1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CARHSP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| CASP3 | Affinity Capture-Western | physical | 22238643, (Europe PMC) | NA | BioGRID |
| CBX1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CCDC32 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| CCDC70 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CCHCR1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CCNC | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CCND2 | Affinity Capture-MS | physical | 27371349, (Europe PMC) | NA | BioGRID |
| CCNDBP1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CCNO | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CDC123 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CDC5L | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 20467437, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| CDC73 | Affinity Capture-MS | physical | 27462432, (Europe PMC) | NA | BioGRID |
| CDK1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| CDK5RAP3 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| CENPK | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CEP57 | Affinity Capture-MS | physical | 23443559, (Europe PMC) | NA | BioGRID |
| CEP78 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CETN3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CFTR | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation | association, physical | 17110338, 23155000, 26618866, 26627832, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CHUK | Affinity Capture-Western | physical | 16840786, (Europe PMC) | NA | BioGRID |
| CLCN3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| COPS5 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CPSF3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CRK | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| CRNKL1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CRYAA | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, pull down | direct interaction, physical, physical association | 11700327, 12601044, (Europe PMC) | 0.61 | BioGRID, IntAct, MINT |
| CRYAB | Affinity Capture-MS, Affinity Capture-Western, Co-purification, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, nuclear magnetic resonance, pull down, two hybrid | direct interaction, physical, physical association | 11700327, 12601044, 1560006, 17916631, 18330356, 20863832, 23188086, 23532854, 26186194, 28514442, (Europe PMC) | 0.79 | BioGRID, IntAct, MINT |
| CRYBB2 | Affinity Capture-Western, Two-hybrid, pull down | direct interaction, physical | 11700327, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| CRYGC | Two-hybrid | physical | 12601044, (Europe PMC) | NA | BioGRID |
| CS | Reconstituted Complex | physical | 10383393, (Europe PMC) | NA | BioGRID |
| CSRP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| CUL3 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CYCS | Affinity Capture-Western | physical | 11784858, (Europe PMC) | NA | BioGRID |
| CYLD | Affinity Capture-MS | physical | 27591049, (Europe PMC) | NA | BioGRID |
| DAXX | Affinity Capture-Western, Co-localization, proximity ligation assay, pull down, two hybrid | physical, physical association | 11003656, 25241761, (Europe PMC) | 0.65 | BioGRID, IntAct, MINT |
| DES | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| DFFA | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| DLST | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DMAP1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| DMWD | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| DNAJC21 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| DUSP16 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| DUT | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ECPAS | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| EDEM3 | Affinity Capture-MS | physical | 28366632, (Europe PMC) | NA | BioGRID |
| EEF1A1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| EEF1B2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| EEF1D | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| EFTUD2 | Affinity Capture-Luminescence, Two-hybrid, anti tag coimmunoprecipitation, two hybrid | physical, physical association | 22365833, (Europe PMC) | 0.51 | BioGRID, IntAct, MINT |
| EGFR | Affinity Capture-MS, anti bait coimmunoprecipitation, proximity ligation assay, tandem affinity purification | association, physical, physical association | 15657067, 23397142, 24189400, (Europe PMC) | 0.67 | BioGRID, IntAct |
| EHD1 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| EIF1AX | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EIF2S1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EIF3M | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| EIF4A2 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| EIF4B | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| EIF4G2 | Affinity Capture-Western, Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| EIF4G3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EIF5 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ENPP2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EPB41L1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EPB41L2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EPB41L3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ERCC5 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ERICH6 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ERP29 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ESR1 | Affinity Capture-MS, Reconstituted Complex | physical | 20348541, 23576398, (Europe PMC) | NA | BioGRID |
| EZH2 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| FAM71D | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FKBP4 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| FLNB | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FN1 | Affinity Capture-MS | physical | 19738201, (Europe PMC) | NA | BioGRID |
| FTH1 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| FXR1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| G6PD | Affinity Capture-Western, Co-fractionation, anti bait coimmunoprecipitation | physical, physical association | 21157431, 26344197, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| GAPVD1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GARS | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GATA1 | Affinity Capture-Western, Two-hybrid | physical | 20410505, (Europe PMC) | NA | BioGRID |
| GDI2 | Co-fractionation, Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, 26344197, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GLMN | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GLO1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| GLOD4 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| GMPS | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| GNPAT | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GOLGA8A | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GRIPAP1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GRK3 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| GRPEL1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| GSTO1 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| GTSF1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GUCA1A | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HAUS1 | Affinity Capture-MS | physical | 23443559, (Europe PMC) | NA | BioGRID |
| HAUS8 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HDAC6 | Affinity Capture-Western | physical | 22238643, (Europe PMC) | NA | BioGRID |
| HDLBP | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HECTD1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HMGN5 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| HNRNPA1 | Affinity Capture-MS | physical | 25324306, (Europe PMC) | NA | BioGRID |
| HNRNPA2B1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HNRNPD | Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, FRET | physical | 18573886, 21245386, 23530064, (Europe PMC) | NA | BioGRID |
| HNRNPF | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HNRNPH1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| HNRNPH2 | Co-fractionation, Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, 26344197, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HNRNPH3 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| HNRNPU | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| HSF1 | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western | physical | 19597476, 25036637, (Europe PMC) | NA | BioGRID |
| HSP90AA1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HSP90AB1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HSPA4 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HSPA5 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| HSPA8 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| HSPA9 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| HSPB1 | Reconstituted Complex, Two-hybrid, luminescence based mammalian interactome mapping, pull down, reverse ras recruitment system, two hybrid | physical, physical association | 10383393, 11003656, 22365833, 25036637, 25277244, (Europe PMC) | 0.77 | BioGRID, IntAct, MINT |
| HSPB6 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| HSPB8 | Affinity Capture-Western, Two-hybrid, fluorescent resonance energy transfer, two hybrid | physical, physical association | 14594798, 15122253, (Europe PMC) | 0.51 | BioGRID, IntAct |
| HUWE1 | Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25147182, 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| HYPK | Affinity Capture-MS | physical | 23272104, (Europe PMC) | NA | BioGRID |
| IARS2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| IGBP1 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| IGSF21 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| IKBKB | Affinity Capture-Western | physical | 16840786, (Europe PMC) | NA | BioGRID |
| ILK | Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | association, physical, physical association | 17353931, 25852190, (Europe PMC) | 0.56 | BioGRID, IntAct |
| INPP5K | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| INS | Reconstituted Complex | physical | 10383393, (Europe PMC) | NA | BioGRID |
| IPO7 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| IQCB1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21565611, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IRAK1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IRS4 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ISG15 | Affinity Capture-Western | physical | 16815975, (Europe PMC) | NA | BioGRID |
| ISG20L2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ITGA4 | Affinity Capture-MS | physical | 22623428, (Europe PMC) | NA | BioGRID |
| ITPA | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| JPT1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| JPT2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| KANSL1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KCMF1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KCTD3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KEAP1 | Affinity Capture-MS | physical | 27621311, (Europe PMC) | NA | BioGRID |
| KLC1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KNSTRN | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| KPNA3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KRT18 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KRT72 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| LASP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| LBP | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| LCE3A | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 25036637, (Europe PMC) | 0.40 | BioGRID, IntAct |
| LIG1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| LIMK2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LONRF1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| LRIF1 | Two-hybrid | physical | 16169070, (Europe PMC) | NA | BioGRID |
| LSM3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| LUZP1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MAGED1 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| MAP3K7 | Affinity Capture-Western | physical | 24686082, (Europe PMC) | NA | BioGRID |
| MAPK14 | Biochemical Activity | physical | 10908726, (Europe PMC) | NA | BioGRID |
| MAPKAPK2 | Affinity Capture-Western, Biochemical Activity, Co-localization, Reconstituted Complex, protein kinase assay, proximity ligation assay | phosphorylation reaction, physical, physical association | 10383393, 10978313, 11042204, 11839738, 11844797, 12740362, 12829704, 14499342, 14688255, 15850461, 17170118, 18326031, 21131586, 21575178, 25241761, 26616734, 8774846, 8995385, (Europe PMC) | 0.61 | BioGRID, IntAct |
| MAPKAPK3 | Biochemical Activity, Co-localization, protein kinase assay, proximity ligation assay | phosphorylation reaction, physical, physical association | 21575178, 25241761, 8774846, (Europe PMC) | 0.61 | BioGRID, IntAct |
| MAPKAPK5 | Affinity Capture-Western, Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 10978313, 19166925, 21575178, 9628874, (Europe PMC) | 0.44 | BioGRID, IntAct |
| MCM2 | Affinity Capture-MS | physical | 25963833, (Europe PMC) | NA | BioGRID |
| MCM6 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MED31 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MFAP1 | Two-hybrid | physical | 22365833, (Europe PMC) | NA | BioGRID |
| MME | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, confocal microscopy | association, colocalization, physical, physical association | 17342744, (Europe PMC) | 0.54 | BioGRID, IntAct |
| MPHOSPH6 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MRGBP | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MRPL28 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MRPL40 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MRPS23 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MSL1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MSN | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| MTIF2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MYC | Affinity Capture-MS, tandem affinity purification | association, physical | 17314511, 21150319, (Europe PMC) | 0.53 | BioGRID, IntAct |
| MYL12A | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MYL12B | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MYL9 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MYLK | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NAMPT | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| NAP1L1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NAPA | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NBAS | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NCKIPSD | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NEK10 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NEXN | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| NFU1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NOS2 | Affinity Capture-MS | physical | 23438482, (Europe PMC) | NA | BioGRID |
| NPM1 | Affinity Capture-MS | physical | 23402259, (Europe PMC) | NA | BioGRID |
| NRDC | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| NSMCE4A | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| NVL | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| OBSL1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| OLA1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| OPTN | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| OSBPL9 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| OXCT1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PAF1 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| PAICS | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PALLD | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| PALM3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PCSK9 | Affinity Capture-MS | physical | 23085658, (Europe PMC) | NA | BioGRID |
| PDHA1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PDLIM1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PELO | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PEX19 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| PFDN2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PGM2 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| PHF12 | Affinity Capture-MS | physical | 26841866, (Europe PMC) | NA | BioGRID |
| PHLDA1 | Affinity Capture-Western | physical | 17024176, (Europe PMC) | NA | BioGRID |
| PHYHIPL | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PITPNA | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PITPNB | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PKM | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PLG | Far Western, Reconstituted Complex | physical | 17206383, (Europe PMC) | NA | BioGRID |
| PNISR | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PNPT1 | Co-fractionation, Two-hybrid, reverse ras recruitment system | physical, physical association | 22939629, 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PPA1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PPM1A | Two-hybrid, reverse ras recruitment system, two hybrid array | physical, physical association | 21988832, 25277244, (Europe PMC) | 0.55 | BioGRID, IntAct |
| PPP2R3C | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PRDX6 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PRKCD | Affinity Capture-Western | physical | 15731106, (Europe PMC) | NA | BioGRID |
| PRKD1 | Biochemical Activity, Reconstituted Complex | physical | 15728188, (Europe PMC) | NA | BioGRID |
| PRPF19 | Two-hybrid | physical | 22365833, (Europe PMC) | NA | BioGRID |
| PRPF40A | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PSAT1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PSMA3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PSMA6 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PSMB2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PSMC1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PSMD1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PTBP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PTGES3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PTPN22 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| PTPN3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PTPRA | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PUM1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RAB41 | Affinity Capture-Western, Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| RAD23A | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RALA | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RASSF9 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RBM25 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RBM39 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RBM48 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RBPJ | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RBX1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RNF114 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPA1 | Affinity Capture-MS | physical | 24332808, (Europe PMC) | NA | BioGRID |
| RPA2 | Affinity Capture-MS | physical | 24332808, (Europe PMC) | NA | BioGRID |
| RPA3 | Affinity Capture-MS | physical | 24332808, (Europe PMC) | NA | BioGRID |
| RPAP3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RPSA | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| RSPH3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RYBP | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| S100A4 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SARS | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| SAT1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SBF1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SDHA | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| SEC13 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SEPHS1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| SERTAD1 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SF3A3 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| SF3B3 | Two-hybrid, two hybrid | physical, physical association | 22365833, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SIK2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SLC7A9 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SMARCA2 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| SMARCA4 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SMARCD1 | Two-hybrid | physical | 21988832, (Europe PMC) | NA | BioGRID |
| SMN1 | Affinity Capture-Western | physical | 17916631, (Europe PMC) | NA | BioGRID |
| SMURF2 | Affinity Capture-Western | physical | 21967197, (Europe PMC) | NA | BioGRID |
| SNCA | Affinity Capture-MS, Reconstituted Complex | physical | 19651786, 21905118, (Europe PMC) | NA | BioGRID |
| SNRNP200 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SNRPF | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SNW1 | Affinity Capture-MS, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | association, physical, physical association | 20467437, 25277244, (Europe PMC) | 0.55 | BioGRID, IntAct, MINT |
| SOX2 | Affinity Capture-MS | physical | 23667531, (Europe PMC) | NA | BioGRID |
| SPACA7 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| SPATA7 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SPIN1 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| SPTBN1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SQSTM1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SRMS | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 25852190, (Europe PMC) | 0.40 | BioGRID, IntAct |
| SRP72 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SRRM2 | Affinity Capture-MS | physical | 16159877, (Europe PMC) | NA | BioGRID |
| STAT2 | Affinity Capture-Western | physical | 22238643, (Europe PMC) | NA | BioGRID |
| STIP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| STMN1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| STRN | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STUB1 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| SUPT5H | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SYCE1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TARBP2 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| TARDBP | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TARS | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TBC1D1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TBC1D3B | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TCPT | Affinity Capture-Western | physical | 25277244, (Europe PMC) | NA | BioGRID |
| TES | Affinity Capture-MS, Co-fractionation | physical | 26344197, 28378594, (Europe PMC) | NA | BioGRID |
| TGFB1I1 | Affinity Capture-Western, Two-hybrid | physical | 11546764, 24831009, (Europe PMC) | NA | BioGRID |
| THOC5 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TJP2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TKT | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TMCO3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TNF | Affinity Capture-RNA | physical | 21245386, (Europe PMC) | NA | BioGRID |
| TOMM70 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| TOX4 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TP53 | Affinity Capture-Western, Co-localization, Two-hybrid, anti bait coimmunoprecipitation, proximity ligation assay, two hybrid pooling approach | physical, physical association | 16169070, 17184779, 25241761, (Europe PMC) | 0.69 | BioGRID, IntAct, MINT |
| TPM3 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| TPT1 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| TRIM24 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TRIM25 | Affinity Capture-MS | physical | 29117863, (Europe PMC) | NA | BioGRID |
| TRIM54 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TSNAXIP1 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| TTC3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TTC39C | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TUBA1C | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TUBA4A | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TXNL1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TYK2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| UAP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| UBA2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| UBC | Affinity Capture-MS | physical | 16196087, (Europe PMC) | NA | BioGRID |
| UBE2I | Affinity Capture-Western | physical | 19597476, 23155000, (Europe PMC) | NA | BioGRID |
| UBE2N | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| UBL4A | Affinity Capture-MS | physical | 23246001, (Europe PMC) | NA | BioGRID |
| UCHL5 | Reconstituted Complex | physical | 21800051, (Europe PMC) | NA | BioGRID |
| UFD1 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| UGDH | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| UNG | Affinity Capture-Western, Reconstituted Complex | physical | 10629618, (Europe PMC) | NA | BioGRID |
| UQCC2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| UQCRB | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| USP1 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| USP14 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| USP38 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| VCAM1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, 22623428, (Europe PMC) | 0.35 | BioGRID, IntAct |
| VCP | Affinity Capture-MS | physical | 23383273, (Europe PMC) | NA | BioGRID |
| VIM | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| WASHC3 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| WDR66 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| WDR83 | Two-hybrid, two hybrid | physical, physical association | 22365833, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| WWOX | Affinity Capture-MS | physical | 24550385, (Europe PMC) | NA | BioGRID |
| WWP1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| XPO1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| XRCC5 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| YAP1 | Affinity Capture-MS | physical | 25796446, (Europe PMC) | NA | BioGRID |
| YWHAB | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| YWHAE | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| YWHAH | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| YWHAQ | Affinity Capture-MS, Two-hybrid, reverse ras recruitment system | physical, physical association | 20618440, 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| YWHAZ | Two-hybrid, pull down, reverse ras recruitment system, tandem affinity purification | association, physical, physical association | 15161933, 20618440, 25277244, (Europe PMC) | 0.68 | BioGRID, IntAct, MINT |
| ZBTB1 | Affinity Capture-MS | physical | 24657165, (Europe PMC) | NA | BioGRID |
| ZBTB17 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ZBTB37 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ZFAT | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ZNF131 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ZNF197 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ZNRF3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ZYX | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AATK | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ACAP2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ACBD6 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ACTN1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ACTN2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ACTN4 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| ADCY9 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ADD3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ADPRHL2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| AGAP3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| AGAP4 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| AGAP5 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| AGAP7P | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| AGAP9 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| AKT1 | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, proximity ligation assay | physical, physical association | 11042204, 12740362, 17510053, 23397142, (Europe PMC) | 0.40 | BioGRID, IntAct |
| ALPI | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| AMD1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ANAPC7 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ANG | anti bait coimmunoprecipitation | association | 28777577, (Europe PMC) | 0.35 | IntAct, MINT |
| ANK1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ANKRD7 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ANXA1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| AP2B1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| APPL1 | two hybrid fragment pooling approach | physical association | 23414517, (Europe PMC) | 0.37 | IntAct |
| ARAF | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ARHGAP28 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ARHGEF7 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ARIH1 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| ARMC6 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ARMT1 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| ARRDC5 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ATF2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 22304920, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ATXN10 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| BAG3 | Affinity Capture-Luminescence, Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping, reverse ras recruitment system | association, physical, physical association | 25036637, 25277244, 26496610, (Europe PMC) | 0.72 | BioGRID, IntAct |
| BICDL1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| BRF2 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| BUB1B | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| BVES | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| C12orf10 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| C2orf73 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CALR | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| CAMK1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CBX1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CCDC32 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| CCDC70 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CCHCR1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CCNC | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CCNDBP1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CCNO | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CDC123 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CDC5L | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 20467437, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| CDK5RAP3 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| CENPK | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CEP78 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CETN3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CFTR | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation | association, physical | 17110338, 23155000, 26618866, 26627832, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CIAO1 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| CLCN3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CPSF3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CRNKL1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CRYAA | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, pull down | direct interaction, physical, physical association | 11700327, 12601044, (Europe PMC) | 0.61 | BioGRID, IntAct, MINT |
| CRYAB | Affinity Capture-MS, Affinity Capture-Western, Co-purification, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, nuclear magnetic resonance, pull down, two hybrid | direct interaction, physical, physical association | 11700327, 12601044, 1560006, 17916631, 18330356, 20863832, 23188086, 23532854, 26186194, 28514442, (Europe PMC) | 0.79 | BioGRID, IntAct, MINT |
| CRYBB2 | Affinity Capture-Western, Two-hybrid, pull down | direct interaction, physical | 11700327, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| CT55 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| DAXX | Affinity Capture-Western, Co-localization, proximity ligation assay, pull down, two hybrid | physical, physical association | 11003656, 25241761, (Europe PMC) | 0.65 | BioGRID, IntAct, MINT |
| DES | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| DFFA | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| DLST | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DMAP1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| DMWD | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| DNAJC21 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| E2F6 | tandem affinity purification | association | 27705803, (Europe PMC) | 0.35 | IntAct |
| ECPAS | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| EFTUD2 | Affinity Capture-Luminescence, Two-hybrid, anti tag coimmunoprecipitation, two hybrid | physical, physical association | 22365833, (Europe PMC) | 0.51 | BioGRID, IntAct, MINT |
| EGFR | Affinity Capture-MS, anti bait coimmunoprecipitation, proximity ligation assay, tandem affinity purification | association, physical, physical association | 15657067, 23397142, 24189400, (Europe PMC) | 0.67 | BioGRID, IntAct |
| EHD1 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| EIF1AX | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EIF2S1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EIF3M | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| EIF4A2 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| EIF4G1 | filter binding | direct interaction | 10859165, (Europe PMC) | 0.44 | IntAct, MINT |
| EIF4G2 | anti bait coimmunoprecipitation, reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.51 | IntAct |
| EIF4G3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EIF5 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ENPP2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EPB41L1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EPB41L2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EPB41L3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ERCC5 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ERICH6 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| F13A1 | proximity ligation assay | physical association | 23397142, (Europe PMC) | 0.40 | IntAct |
| FAM71D | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FKBP4 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| FLNB | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FTH1 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| FXR1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| G6PD | Affinity Capture-Western, Co-fractionation, anti bait coimmunoprecipitation | physical, physical association | 21157431, 26344197, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| GABARAPL1 | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GABARAPL2 | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GAPVD1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GARS | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GDI2 | Co-fractionation, Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, 26344197, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GET4 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| GLMN | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GNPAT | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GOLGA8A | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GRB2 | pull down | association | 12577067, (Europe PMC) | 0.35 | IntAct |
| GRIPAP1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GRK3 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| GSTO1 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| GTSF1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GUCA1A | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HAUS8 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HDLBP | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HECTD1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HINFP | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| HNRNPA2B1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HNRNPF | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HNRNPH2 | Co-fractionation, Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, 26344197, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HNRNPU | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| HSF1 | anti tag coimmunoprecipitation | association | 25036637, (Europe PMC) | 0.35 | IntAct |
| HSP90AA1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HSP90AB1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HSPA4 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HSPA5 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| HSPB1 | Reconstituted Complex, Two-hybrid, luminescence based mammalian interactome mapping, pull down, reverse ras recruitment system, two hybrid | physical, physical association | 10383393, 11003656, 22365833, 25036637, 25277244, (Europe PMC) | 0.77 | BioGRID, IntAct, MINT |
| HSPB8 | Affinity Capture-Western, Two-hybrid, fluorescent resonance energy transfer, two hybrid | physical, physical association | 14594798, 15122253, (Europe PMC) | 0.51 | BioGRID, IntAct |
| HUWE1 | Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25147182, 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| IARS2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| IGBP1 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| IGSF21 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ILK | Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | association, physical, physical association | 17353931, 25852190, (Europe PMC) | 0.56 | BioGRID, IntAct |
| INPP5K | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| IQCB1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21565611, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IRAK1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IRS4 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ISG20L2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KANSL1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KCMF1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KCTD3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KLC1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KNSTRN | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| KPNA3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KRT18 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KRT72 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KSR1 | anti tag coimmunoprecipitation | association | 27086506, (Europe PMC) | 0.35 | IntAct |
| LBHD1 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| LBP | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| LCE3A | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 25036637, (Europe PMC) | 0.40 | BioGRID, IntAct |
| LIG1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| LIMK2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LONRF1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| LRRK2 | tandem affinity purification | association | 24725412, (Europe PMC) | 0.35 | IntAct |
| LSM3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| LUZP1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MAGEA6 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| MAGED1 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| MAP1LC3A | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| MAP1LC3B | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| MAPK6 | anti tag coimmunoprecipitation | association | 26972000, (Europe PMC) | 0.35 | IntAct |
| MAPKAPK2 | Affinity Capture-Western, Biochemical Activity, Co-localization, Reconstituted Complex, protein kinase assay, proximity ligation assay | phosphorylation reaction, physical, physical association | 10383393, 10978313, 11042204, 11839738, 11844797, 12740362, 12829704, 14499342, 14688255, 15850461, 17170118, 18326031, 21131586, 21575178, 25241761, 26616734, 8774846, 8995385, (Europe PMC) | 0.61 | BioGRID, IntAct |
| MAPKAPK3 | Biochemical Activity, Co-localization, protein kinase assay, proximity ligation assay | phosphorylation reaction, physical, physical association | 21575178, 25241761, 8774846, (Europe PMC) | 0.61 | BioGRID, IntAct |
| MAPKAPK5 | Affinity Capture-Western, Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 10978313, 19166925, 21575178, 9628874, (Europe PMC) | 0.44 | BioGRID, IntAct |
| MCM6 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MED31 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MFAP1 | two hybrid | physical association | 22365833, (Europe PMC) | 0.37 | IntAct, MINT |
| MME | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, confocal microscopy | association, colocalization, physical, physical association | 17342744, (Europe PMC) | 0.54 | BioGRID, IntAct |
| MPHOSPH6 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MRGBP | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MRPL28 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MRPL40 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MRPS23 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MSL1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MTIF2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MYC | Affinity Capture-MS, tandem affinity purification | association, physical | 17314511, 21150319, (Europe PMC) | 0.53 | BioGRID, IntAct |
| MYL12A | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MYL12B | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MYL9 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MYLK | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NAP1L1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NAPA | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NBAS | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NBEAL2 | tandem affinity purification | association | 29187380, (Europe PMC) | 0.35 | IntAct |
| NCKIPSD | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NEK10 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NEXN | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| NFU1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NSMCE4A | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NVL | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| OBSL1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| OPTN | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| OSBPL9 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PAF1 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| PALM3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PASK | peptide array | phosphorylation reaction | 21418524, (Europe PMC) | 0.44 | IntAct, MINT |
| PCGF5 | tandem affinity purification | association | 27705803, (Europe PMC) | 0.35 | IntAct |
| PDHA1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PELO | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PGM2 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| PHYHIPL | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PNISR | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PNPT1 | Co-fractionation, Two-hybrid, reverse ras recruitment system | physical, physical association | 22939629, 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PPA1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PPM1A | Two-hybrid, reverse ras recruitment system, two hybrid array | physical, physical association | 21988832, 25277244, (Europe PMC) | 0.55 | BioGRID, IntAct |
| PPP2R3C | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PRPF19 | two hybrid | physical association | 22365833, (Europe PMC) | 0.37 | IntAct, MINT |
| PRPF40A | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PSMA3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PSMA6 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PSMB2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PSMC1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PSMD1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PSMD6 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| PTBP3 | anti bait coimmunoprecipitation | association | 22575643, (Europe PMC) | 0.35 | IntAct, MINT |
| PTGES3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PTPN3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PTPRA | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RAB43 | anti bait coimmunoprecipitation, reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.51 | IntAct |
| RAD23A | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RALA | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RASSF9 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RBM25 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RBM39 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RBM48 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RBPJ | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RBX1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RIF1 | two hybrid pooling approach | physical association | 16169070, (Europe PMC) | 0.37 | IntAct |
| RPAP3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RPSA | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| RSPH3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RYBP | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| S100A4 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SAP18 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| SAT1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SBF1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SEC13 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SERTAD1 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SF3A3 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| SF3B3 | Two-hybrid, two hybrid | physical, physical association | 22365833, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SIK2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SIM2 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| SLC7A9 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SLX4 | anti tag coimmunoprecipitation | association | 19596235, (Europe PMC) | 0.35 | IntAct |
| SMARCA2 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| SMARCA4 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SMARCD1 | two hybrid | physical association | 21988832, (Europe PMC) | 0.37 | IntAct |
| SNRNP200 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SNRPF | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SNW1 | Affinity Capture-MS, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | association, physical, physical association | 20467437, 25277244, (Europe PMC) | 0.55 | BioGRID, IntAct, MINT |
| SPACA7 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| SPATA7 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SPIN1 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| SPTBN1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SQSTM1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SRMS | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 25852190, (Europe PMC) | 0.40 | BioGRID, IntAct |
| SRP72 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| STK4 | tandem affinity purification | association | 23386615, (Europe PMC) | 0.35 | IntAct |
| STRN | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STUB1 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| SUPT5H | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SYCE1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TARBP2 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| TARS | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TBC1D1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TBC1D3B | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| THOC5 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TJP2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TMCO3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TOMM70 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| TOX4 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TP53 | Affinity Capture-Western, Co-localization, Two-hybrid, anti bait coimmunoprecipitation, proximity ligation assay, two hybrid pooling approach | physical, physical association | 16169070, 17184779, 25241761, (Europe PMC) | 0.69 | BioGRID, IntAct, MINT |
| TPT1 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| TRIM24 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TRIM54 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TSC22D1 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| TSNAXIP1 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| TTC3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TTC39C | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TUBA1A | pull down | association | 27291054, (Europe PMC) | 0.35 | IntAct |
| TUBA1C | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TUBB3 | pull down | association | 27291054, (Europe PMC) | 0.35 | IntAct |
| TXNL1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TYK2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| UFD1 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| UQCC2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| UQCRB | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| USP1 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| USP38 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| VCAM1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, 22623428, (Europe PMC) | 0.35 | BioGRID, IntAct |
| VIM | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| WASHC3 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| WDR66 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| WDR83 | Two-hybrid, two hybrid | physical, physical association | 22365833, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| WWP1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| XPO1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| XRCC5 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| YWHAB | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| YWHAE | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| YWHAH | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| YWHAQ | Affinity Capture-MS, Two-hybrid, reverse ras recruitment system | physical, physical association | 20618440, 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| YWHAZ | Two-hybrid, pull down, reverse ras recruitment system, tandem affinity purification | association, physical, physical association | 15161933, 20618440, 25277244, (Europe PMC) | 0.68 | BioGRID, IntAct, MINT |
| ZBTB17 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ZBTB37 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ZFAT | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ZNF131 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ZNF197 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ZNRF3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| CDC5L | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 20467437, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| CRYAA | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, pull down | direct interaction, physical, physical association | 11700327, 12601044, (Europe PMC) | 0.61 | BioGRID, IntAct, MINT |
| CRYAB | Affinity Capture-MS, Affinity Capture-Western, Co-purification, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, nuclear magnetic resonance, pull down, two hybrid | direct interaction, physical, physical association | 11700327, 12601044, 1560006, 17916631, 18330356, 20863832, 23188086, 23532854, 26186194, 28514442, (Europe PMC) | 0.79 | BioGRID, IntAct, MINT |
| CRYBB2 | Affinity Capture-Western, Two-hybrid, pull down | direct interaction, physical | 11700327, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| DAXX | Affinity Capture-Western, Co-localization, proximity ligation assay, pull down, two hybrid | physical, physical association | 11003656, 25241761, (Europe PMC) | 0.65 | BioGRID, IntAct, MINT |
| EFTUD2 | Affinity Capture-Luminescence, Two-hybrid, anti tag coimmunoprecipitation, two hybrid | physical, physical association | 22365833, (Europe PMC) | 0.51 | BioGRID, IntAct, MINT |
| EIF4G1 | filter binding | direct interaction | 10859165, (Europe PMC) | 0.44 | IntAct, MINT |
| G6PD | Affinity Capture-Western, Co-fractionation, anti bait coimmunoprecipitation | physical, physical association | 21157431, 26344197, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| HSPB1 | Reconstituted Complex, Two-hybrid, luminescence based mammalian interactome mapping, pull down, reverse ras recruitment system, two hybrid | physical, physical association | 10383393, 11003656, 22365833, 25036637, 25277244, (Europe PMC) | 0.77 | BioGRID, IntAct, MINT |
| MFAP1 | two hybrid | physical association | 22365833, (Europe PMC) | 0.37 | IntAct, MINT |
| PASK | peptide array | phosphorylation reaction | 21418524, (Europe PMC) | 0.44 | IntAct, MINT |
| PRPF19 | two hybrid | physical association | 22365833, (Europe PMC) | 0.37 | IntAct, MINT |
| PTBP3 | anti bait coimmunoprecipitation | association | 22575643, (Europe PMC) | 0.35 | IntAct, MINT |
| SF3B3 | Two-hybrid, two hybrid | physical, physical association | 22365833, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SNW1 | Affinity Capture-MS, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | association, physical, physical association | 20467437, 25277244, (Europe PMC) | 0.55 | BioGRID, IntAct, MINT |
| TP53 | Affinity Capture-Western, Co-localization, Two-hybrid, anti bait coimmunoprecipitation, proximity ligation assay, two hybrid pooling approach | physical, physical association | 16169070, 17184779, 25241761, (Europe PMC) | 0.69 | BioGRID, IntAct, MINT |
| WDR83 | Two-hybrid, two hybrid | physical, physical association | 22365833, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| YWHAZ | Two-hybrid, pull down, reverse ras recruitment system, tandem affinity purification | association, physical, physical association | 15161933, 20618440, 25277244, (Europe PMC) | 0.68 | BioGRID, IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AATK | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ACAP2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ACBD6 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ACTN1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ACTN2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ACTN4 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| ACTN4 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| ADCY9 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ADD3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ADPRHL2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| AGAP10P | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| AGAP3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| AGAP4 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| AGAP4 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| AGAP5 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| AGAP7P | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| AGAP9 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| AHCY | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| AHNAK | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| AKT1 | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, proximity ligation assay | physical, physical association | 11042204, 12740362, 17510053, 23397142, (Europe PMC) | 0.40 | BioGRID, IntAct |
| ALPI | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| AMD1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ANAPC7 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ANG | anti bait coimmunoprecipitation | association | 28777577, (Europe PMC) | 0.35 | IntAct, MINT |
| ANK1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ANKRD7 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ANXA1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| AP2B1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| APPL1 | two hybrid fragment pooling approach | physical association | 23414517, (Europe PMC) | 0.37 | IntAct |
| ARAF | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ARHGAP28 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ARHGDIA | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ARHGEF7 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ARIH1 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| ARIH1 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| ARMC6 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ARMT1 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| ARMT1 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| ARRDC5 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ASB10 | Affinity Capture-MS | physical | 24337577, (Europe PMC) | NA | BioGRID |
| ASB17 | Affinity Capture-MS | physical | 24337577, (Europe PMC) | NA | BioGRID |
| ASB4 | Affinity Capture-MS | physical | 24337577, (Europe PMC) | NA | BioGRID |
| ASB6 | Affinity Capture-MS | physical | 24337577, (Europe PMC) | NA | BioGRID |
| ATF2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 22304920, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ATIC | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ATXN10 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| BAG3 | Affinity Capture-Luminescence, Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping, reverse ras recruitment system | association, physical, physical association | 25036637, 25277244, 26496610, (Europe PMC) | 0.72 | BioGRID, IntAct |
| BICDL1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| BRCA1 | Affinity Capture-MS | physical | 26831064, (Europe PMC) | NA | BioGRID |
| BRF2 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| BTRC | Affinity Capture-MS | physical | 25900982, (Europe PMC) | NA | BioGRID |
| BUB1B | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| BVES | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| BVES | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| C11orf98 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| C12orf10 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| C2orf73 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CALR | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| CAMK1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CARHSP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| CASP3 | Affinity Capture-Western | physical | 22238643, (Europe PMC) | NA | BioGRID |
| CBX1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CCDC32 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| CCDC32 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| CCDC70 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CCHCR1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CCNC | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CCND2 | Affinity Capture-MS | physical | 27371349, (Europe PMC) | NA | BioGRID |
| CCNDBP1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CCNO | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CDC123 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CDC5L | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 20467437, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| CDC73 | Affinity Capture-MS | physical | 27462432, (Europe PMC) | NA | BioGRID |
| CDK1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| CDK5RAP3 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| CDK5RAP3 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| CENPK | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CEP57 | Affinity Capture-MS | physical | 23443559, (Europe PMC) | NA | BioGRID |
| CEP78 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CETN3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CFTR | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation | association, physical | 17110338, 23155000, 26618866, 26627832, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CHUK | Affinity Capture-Western | physical | 16840786, (Europe PMC) | NA | BioGRID |
| CIAO1 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| CLCN3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| COPS5 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CPSF3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CRK | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| CRNKL1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CRYAA | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, pull down | direct interaction, physical, physical association | 11700327, 12601044, (Europe PMC) | 0.61 | BioGRID, IntAct, MINT |
| CRYAB | Affinity Capture-MS, Affinity Capture-Western, Co-purification, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, nuclear magnetic resonance, pull down, two hybrid | direct interaction, physical, physical association | 11700327, 12601044, 1560006, 17916631, 18330356, 20863832, 23188086, 23532854, 26186194, 28514442, (Europe PMC) | 0.79 | BioGRID, IntAct, MINT |
| CRYBB2 | Affinity Capture-Western, Two-hybrid, pull down | direct interaction, physical | 11700327, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| CRYGC | Two-hybrid | physical | 12601044, (Europe PMC) | NA | BioGRID |
| CS | Reconstituted Complex | physical | 10383393, (Europe PMC) | NA | BioGRID |
| CSRP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| CT55 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| CUL3 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CYCS | Affinity Capture-Western | physical | 11784858, (Europe PMC) | NA | BioGRID |
| CYLD | Affinity Capture-MS | physical | 27591049, (Europe PMC) | NA | BioGRID |
| DAXX | Affinity Capture-Western, Co-localization, proximity ligation assay, pull down, two hybrid | physical, physical association | 11003656, 25241761, (Europe PMC) | 0.65 | BioGRID, IntAct, MINT |
| DES | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| DFFA | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| DLST | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DMAP1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| DMWD | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| DNAJC21 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| DUSP16 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| DUT | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| E2F6 | tandem affinity purification | association | 27705803, (Europe PMC) | 0.35 | IntAct |
| ECPAS | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| ECPAS | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| EDEM3 | Affinity Capture-MS | physical | 28366632, (Europe PMC) | NA | BioGRID |
| EEF1A1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| EEF1B2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| EEF1D | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| EFTUD2 | Affinity Capture-Luminescence, Two-hybrid, anti tag coimmunoprecipitation, two hybrid | physical, physical association | 22365833, (Europe PMC) | 0.51 | BioGRID, IntAct, MINT |
| EGFR | Affinity Capture-MS, anti bait coimmunoprecipitation, proximity ligation assay, tandem affinity purification | association, physical, physical association | 15657067, 23397142, 24189400, (Europe PMC) | 0.67 | BioGRID, IntAct |
| EHD1 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| EHD1 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| EIF1AX | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EIF2S1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EIF3M | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| EIF3M | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| EIF4A2 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| EIF4B | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| EIF4G1 | filter binding | direct interaction | 10859165, (Europe PMC) | 0.44 | IntAct, MINT |
| EIF4G2 | Affinity Capture-Western, Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| EIF4G2 | anti bait coimmunoprecipitation, reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.51 | IntAct |
| EIF4G3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EIF5 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ENPP2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EPB41L1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EPB41L2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EPB41L3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ERCC5 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ERICH6 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ERP29 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ESR1 | Affinity Capture-MS, Reconstituted Complex | physical | 20348541, 23576398, (Europe PMC) | NA | BioGRID |
| EZH2 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| F13A1 | proximity ligation assay | physical association | 23397142, (Europe PMC) | 0.40 | IntAct |
| FAM71D | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FKBP4 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| FLNB | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FN1 | Affinity Capture-MS | physical | 19738201, (Europe PMC) | NA | BioGRID |
| FTH1 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| FXR1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| G6PD | Affinity Capture-Western, Co-fractionation, anti bait coimmunoprecipitation | physical, physical association | 21157431, 26344197, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| GABARAPL1 | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GABARAPL2 | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GAPVD1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GARS | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GATA1 | Affinity Capture-Western, Two-hybrid | physical | 20410505, (Europe PMC) | NA | BioGRID |
| GDI2 | Co-fractionation, Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, 26344197, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GET4 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| GLMN | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GLO1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| GLOD4 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| GMPS | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| GNPAT | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GOLGA8A | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GRB2 | pull down | association | 12577067, (Europe PMC) | 0.35 | IntAct |
| GRIPAP1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GRK3 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| GRK3 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| GRPEL1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| GSTO1 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| GTSF1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GUCA1A | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HAUS1 | Affinity Capture-MS | physical | 23443559, (Europe PMC) | NA | BioGRID |
| HAUS8 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HDAC6 | Affinity Capture-Western | physical | 22238643, (Europe PMC) | NA | BioGRID |
| HDLBP | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HECTD1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HINFP | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| HMGN5 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| HNRNPA1 | Affinity Capture-MS | physical | 25324306, (Europe PMC) | NA | BioGRID |
| HNRNPA2B1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HNRNPD | Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, FRET | physical | 18573886, 21245386, 23530064, (Europe PMC) | NA | BioGRID |
| HNRNPF | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HNRNPH1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| HNRNPH2 | Co-fractionation, Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, 26344197, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HNRNPH3 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| HNRNPU | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| HNRNPU | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| HSF1 | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western | physical | 19597476, 25036637, (Europe PMC) | NA | BioGRID |
| HSF1 | anti tag coimmunoprecipitation | association | 25036637, (Europe PMC) | 0.35 | IntAct |
| HSP90AA1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HSP90AB1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HSPA4 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HSPA5 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| HSPA5 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| HSPA8 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| HSPA9 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| HSPB1 | Reconstituted Complex, Two-hybrid, luminescence based mammalian interactome mapping, pull down, reverse ras recruitment system, two hybrid | physical, physical association | 10383393, 11003656, 22365833, 25036637, 25277244, (Europe PMC) | 0.77 | BioGRID, IntAct, MINT |
| HSPB6 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| HSPB8 | Affinity Capture-Western, Two-hybrid, fluorescent resonance energy transfer, two hybrid | physical, physical association | 14594798, 15122253, (Europe PMC) | 0.51 | BioGRID, IntAct |
| HUWE1 | Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25147182, 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| HYPK | Affinity Capture-MS | physical | 23272104, (Europe PMC) | NA | BioGRID |
| IARS2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| IGBP1 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| IGSF21 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| IKBKB | Affinity Capture-Western | physical | 16840786, (Europe PMC) | NA | BioGRID |
| ILK | Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | association, physical, physical association | 17353931, 25852190, (Europe PMC) | 0.56 | BioGRID, IntAct |
| INPP5K | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| INPP5K | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| INS | Reconstituted Complex | physical | 10383393, (Europe PMC) | NA | BioGRID |
| IPO7 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| IQCB1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21565611, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IRAK1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IRS4 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ISG15 | Affinity Capture-Western | physical | 16815975, (Europe PMC) | NA | BioGRID |
| ISG20L2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ITGA4 | Affinity Capture-MS | physical | 22623428, (Europe PMC) | NA | BioGRID |
| ITPA | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| JPT1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| JPT2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| KANSL1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KCMF1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KCTD3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KEAP1 | Affinity Capture-MS | physical | 27621311, (Europe PMC) | NA | BioGRID |
| KLC1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KNSTRN | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| KNSTRN | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| KPNA3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KRT18 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KRT72 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KSR1 | anti tag coimmunoprecipitation | association | 27086506, (Europe PMC) | 0.35 | IntAct |
| LASP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| LBHD1 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| LBP | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| LCE3A | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 25036637, (Europe PMC) | 0.40 | BioGRID, IntAct |
| LIG1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| LIMK2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LONRF1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| LRIF1 | Two-hybrid | physical | 16169070, (Europe PMC) | NA | BioGRID |
| LRRK2 | tandem affinity purification | association | 24725412, (Europe PMC) | 0.35 | IntAct |
| LSM3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| LUZP1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MAGEA6 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| MAGED1 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| MAP1LC3A | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| MAP1LC3B | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| MAP3K7 | Affinity Capture-Western | physical | 24686082, (Europe PMC) | NA | BioGRID |
| MAPK14 | Biochemical Activity | physical | 10908726, (Europe PMC) | NA | BioGRID |
| MAPK6 | anti tag coimmunoprecipitation | association | 26972000, (Europe PMC) | 0.35 | IntAct |
| MAPKAPK2 | Affinity Capture-Western, Biochemical Activity, Co-localization, Reconstituted Complex, protein kinase assay, proximity ligation assay | phosphorylation reaction, physical, physical association | 10383393, 10978313, 11042204, 11839738, 11844797, 12740362, 12829704, 14499342, 14688255, 15850461, 17170118, 18326031, 21131586, 21575178, 25241761, 26616734, 8774846, 8995385, (Europe PMC) | 0.61 | BioGRID, IntAct |
| MAPKAPK3 | Biochemical Activity, Co-localization, protein kinase assay, proximity ligation assay | phosphorylation reaction, physical, physical association | 21575178, 25241761, 8774846, (Europe PMC) | 0.61 | BioGRID, IntAct |
| MAPKAPK5 | Affinity Capture-Western, Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 10978313, 19166925, 21575178, 9628874, (Europe PMC) | 0.44 | BioGRID, IntAct |
| MCM2 | Affinity Capture-MS | physical | 25963833, (Europe PMC) | NA | BioGRID |
| MCM6 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MED31 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MFAP1 | Two-hybrid | physical | 22365833, (Europe PMC) | NA | BioGRID |
| MFAP1 | two hybrid | physical association | 22365833, (Europe PMC) | 0.37 | IntAct, MINT |
| MME | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, confocal microscopy | association, colocalization, physical, physical association | 17342744, (Europe PMC) | 0.54 | BioGRID, IntAct |
| MPHOSPH6 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MRGBP | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MRPL28 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MRPL40 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MRPS23 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MSL1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MSN | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| MTIF2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MYC | Affinity Capture-MS, tandem affinity purification | association, physical | 17314511, 21150319, (Europe PMC) | 0.53 | BioGRID, IntAct |
| MYL12A | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MYL12B | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MYL9 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MYLK | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NAMPT | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| NAP1L1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NAPA | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NBAS | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NBEAL2 | tandem affinity purification | association | 29187380, (Europe PMC) | 0.35 | IntAct |
| NCKIPSD | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NEK10 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NEXN | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| NEXN | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| NFU1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NOS2 | Affinity Capture-MS | physical | 23438482, (Europe PMC) | NA | BioGRID |
| NPM1 | Affinity Capture-MS | physical | 23402259, (Europe PMC) | NA | BioGRID |
| NRDC | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| NSMCE4A | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| NVL | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| OBSL1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| OLA1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| OPTN | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| OSBPL9 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| OXCT1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PAF1 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| PAICS | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PALLD | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| PALM3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PASK | peptide array | phosphorylation reaction | 21418524, (Europe PMC) | 0.44 | IntAct, MINT |
| PCGF5 | tandem affinity purification | association | 27705803, (Europe PMC) | 0.35 | IntAct |
| PCSK9 | Affinity Capture-MS | physical | 23085658, (Europe PMC) | NA | BioGRID |
| PDHA1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PDLIM1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PELO | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PEX19 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| PFDN2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PGM2 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| PHF12 | Affinity Capture-MS | physical | 26841866, (Europe PMC) | NA | BioGRID |
| PHLDA1 | Affinity Capture-Western | physical | 17024176, (Europe PMC) | NA | BioGRID |
| PHYHIPL | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PITPNA | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PITPNB | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PKM | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PLG | Far Western, Reconstituted Complex | physical | 17206383, (Europe PMC) | NA | BioGRID |
| PNISR | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PNPT1 | Co-fractionation, Two-hybrid, reverse ras recruitment system | physical, physical association | 22939629, 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PPA1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PPM1A | Two-hybrid, reverse ras recruitment system, two hybrid array | physical, physical association | 21988832, 25277244, (Europe PMC) | 0.55 | BioGRID, IntAct |
| PPP2R3C | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PRDX6 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PRKCD | Affinity Capture-Western | physical | 15731106, (Europe PMC) | NA | BioGRID |
| PRKD1 | Biochemical Activity, Reconstituted Complex | physical | 15728188, (Europe PMC) | NA | BioGRID |
| PRPF19 | Two-hybrid | physical | 22365833, (Europe PMC) | NA | BioGRID |
| PRPF19 | two hybrid | physical association | 22365833, (Europe PMC) | 0.37 | IntAct, MINT |
| PRPF40A | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PSAT1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PSMA3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PSMA6 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PSMB2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PSMC1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PSMD1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PSMD6 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| PTBP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PTBP3 | anti bait coimmunoprecipitation | association | 22575643, (Europe PMC) | 0.35 | IntAct, MINT |
| PTGES3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PTPN22 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| PTPN3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PTPRA | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PUM1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RAB41 | Affinity Capture-Western, Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| RAB43 | anti bait coimmunoprecipitation, reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.51 | IntAct |
| RAD23A | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RALA | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RASSF9 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RBM25 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RBM39 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RBM48 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RBPJ | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RBX1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RIF1 | two hybrid pooling approach | physical association | 16169070, (Europe PMC) | 0.37 | IntAct |
| RNF114 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPA1 | Affinity Capture-MS | physical | 24332808, (Europe PMC) | NA | BioGRID |
| RPA2 | Affinity Capture-MS | physical | 24332808, (Europe PMC) | NA | BioGRID |
| RPA3 | Affinity Capture-MS | physical | 24332808, (Europe PMC) | NA | BioGRID |
| RPAP3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RPSA | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| RPSA | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| RSPH3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RYBP | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| S100A4 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SAP18 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| SARS | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| SAT1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SBF1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SDHA | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| SEC13 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SEPHS1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| SERTAD1 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SF3A3 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| SF3B3 | Two-hybrid, two hybrid | physical, physical association | 22365833, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SIK2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SIM2 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| SLC7A9 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SLX4 | anti tag coimmunoprecipitation | association | 19596235, (Europe PMC) | 0.35 | IntAct |
| SMARCA2 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| SMARCA2 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| SMARCA4 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SMARCD1 | Two-hybrid | physical | 21988832, (Europe PMC) | NA | BioGRID |
| SMARCD1 | two hybrid | physical association | 21988832, (Europe PMC) | 0.37 | IntAct |
| SMN1 | Affinity Capture-Western | physical | 17916631, (Europe PMC) | NA | BioGRID |
| SMURF2 | Affinity Capture-Western | physical | 21967197, (Europe PMC) | NA | BioGRID |
| SNCA | Affinity Capture-MS, Reconstituted Complex | physical | 19651786, 21905118, (Europe PMC) | NA | BioGRID |
| SNRNP200 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SNRPF | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SNW1 | Affinity Capture-MS, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | association, physical, physical association | 20467437, 25277244, (Europe PMC) | 0.55 | BioGRID, IntAct, MINT |
| SOX2 | Affinity Capture-MS | physical | 23667531, (Europe PMC) | NA | BioGRID |
| SPACA7 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| SPACA7 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| SPATA7 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SPIN1 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| SPTBN1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SQSTM1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SRMS | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 25852190, (Europe PMC) | 0.40 | BioGRID, IntAct |
| SRP72 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SRRM2 | Affinity Capture-MS | physical | 16159877, (Europe PMC) | NA | BioGRID |
| STAT2 | Affinity Capture-Western | physical | 22238643, (Europe PMC) | NA | BioGRID |
| STIP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| STK4 | tandem affinity purification | association | 23386615, (Europe PMC) | 0.35 | IntAct |
| STMN1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| STRN | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STUB1 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| STUB1 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| SUPT5H | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SYCE1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TARBP2 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| TARBP2 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| TARDBP | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TARS | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TBC1D1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TBC1D3B | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TCPT | Affinity Capture-Western | physical | 25277244, (Europe PMC) | NA | BioGRID |
| TES | Affinity Capture-MS, Co-fractionation | physical | 26344197, 28378594, (Europe PMC) | NA | BioGRID |
| TGFB1I1 | Affinity Capture-Western, Two-hybrid | physical | 11546764, 24831009, (Europe PMC) | NA | BioGRID |
| THOC5 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TJP2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TKT | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TMCO3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TNF | Affinity Capture-RNA | physical | 21245386, (Europe PMC) | NA | BioGRID |
| TOMM70 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| TOMM70 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| TOX4 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TP53 | Affinity Capture-Western, Co-localization, Two-hybrid, anti bait coimmunoprecipitation, proximity ligation assay, two hybrid pooling approach | physical, physical association | 16169070, 17184779, 25241761, (Europe PMC) | 0.69 | BioGRID, IntAct, MINT |
| TPM3 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| TPT1 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| TRIM24 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TRIM25 | Affinity Capture-MS | physical | 29117863, (Europe PMC) | NA | BioGRID |
| TRIM54 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TSC22D1 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| TSNAXIP1 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| TSNAXIP1 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| TTC3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TTC39C | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TUBA1A | pull down | association | 27291054, (Europe PMC) | 0.35 | IntAct |
| TUBA1C | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TUBA4A | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TUBB3 | pull down | association | 27291054, (Europe PMC) | 0.35 | IntAct |
| TXNL1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TYK2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| UAP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| UBA2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| UBC | Affinity Capture-MS | physical | 16196087, (Europe PMC) | NA | BioGRID |
| UBE2I | Affinity Capture-Western | physical | 19597476, 23155000, (Europe PMC) | NA | BioGRID |
| UBE2N | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| UBL4A | Affinity Capture-MS | physical | 23246001, (Europe PMC) | NA | BioGRID |
| UCHL5 | Reconstituted Complex | physical | 21800051, (Europe PMC) | NA | BioGRID |
| UFD1 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| UFD1 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| UGDH | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| UNG | Affinity Capture-Western, Reconstituted Complex | physical | 10629618, (Europe PMC) | NA | BioGRID |
| UQCC2 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| UQCRB | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| USP1 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| USP14 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| USP38 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| VCAM1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, 22623428, (Europe PMC) | 0.35 | BioGRID, IntAct |
| VCP | Affinity Capture-MS | physical | 23383273, (Europe PMC) | NA | BioGRID |
| VIM | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| WASHC3 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| WASHC3 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| WDR66 | Two-hybrid | physical | 25277244, (Europe PMC) | NA | BioGRID |
| WDR66 | reverse ras recruitment system | physical association | 25277244, (Europe PMC) | 0.37 | IntAct |
| WDR83 | Two-hybrid, two hybrid | physical, physical association | 22365833, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| WWOX | Affinity Capture-MS | physical | 24550385, (Europe PMC) | NA | BioGRID |
| WWP1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| XPO1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| XRCC5 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| YAP1 | Affinity Capture-MS | physical | 25796446, (Europe PMC) | NA | BioGRID |
| YWHAB | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| YWHAE | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| YWHAH | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| YWHAQ | Affinity Capture-MS, Two-hybrid, reverse ras recruitment system | physical, physical association | 20618440, 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| YWHAZ | Two-hybrid, pull down, reverse ras recruitment system, tandem affinity purification | association, physical, physical association | 15161933, 20618440, 25277244, (Europe PMC) | 0.68 | BioGRID, IntAct, MINT |
| ZBTB1 | Affinity Capture-MS | physical | 24657165, (Europe PMC) | NA | BioGRID |
| ZBTB17 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ZBTB37 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ZFAT | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ZNF131 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ZNF197 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ZNRF3 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ZYX | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |