Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
FXYD1
Gene Name  | FXYD1 (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: 2JO1 |
| Synonyms | FXYD1 , PLM | |
| Protein Name | FXYD1 | |
| Alternative Name(s) | Phospholemman;FXYD domain-containing ion transport regulator 1;Sodium/potassium-transporting ATPase subunit FXYD1; | |
| Protein Family | Belongs to the FXYD family | |
| EntrezGene ID | 5348 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | O00168 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 10441 Dalton | |
| Protein Length | 92 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000266964 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - ENOG410J08K | eggNOG - ENOG410YYN6 | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cell membrane, sarcolemma Apical cell membrane Membrane, caveola Note=Detected in the apical cellmembrane in brain In myocytes, localizes to sarcolemma, t-tubulesand intercalated disks | |||
| Function (UniProt annotation) | |||
| Associates with and regulates the activity of thesodium/potassium-transporting ATPase (NKA) which transports Na(+)out of the cell and K(+) into the cell Inhibits NKA activity inits unphosphorylated state and stimulates activity whenphosphorylated Reduces glutathionylation of the NKA beta-1subunit ATP1B1, thus reversing glutathionylation-mediatedinhibition of ATP1B1 Contributes to female sexual development bymaintaining the excitability of neurons which secretegonadotropin-releasing hormone | |||
| Catalytic Activity (UniProt annotation) | |||
| N/A | |||
| Protein Sequence | |||
| MASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTF RSSIRRLSTRRR | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0005254 | F:chloride channel activity |
| GO:0005886 | C:plasma membrane |
| GO:0005887 | C:integral component of plasma membrane |
| GO:0005890 | C:sodium:potassium-exchanging ATPase complex |
| GO:0005901 | C:caveola |
| GO:0006813 | P:potassium ion transport |
| GO:0006814 | P:sodium ion transport |
| GO:0006821 | P:chloride transport |
| GO:0006936 | P:muscle contraction |
| GO:0008016 | P:regulation of heart contraction |
| GO:0010734 | P:negative regulation of protein glutathionylation |
| GO:0014704 | C:intercalated disc |
| GO:0016324 | C:apical plasma membrane |
| GO:0017080 | F:sodium channel regulator activity |
| GO:0030315 | C:T-tubule |
| GO:0042383 | C:sarcolemma |
| GO:0044325 | F:ion channel binding |
| GO:0086036 | P:regulation of cardiac muscle cell membrane potential |
| GO:1903278 | P:positive regulation of sodium ion export across plasma membrane |
| GO:2000649 | P:regulation of sodium ion transmembrane transporter activity |
