Top EPOR
Localization (UniProt annotation) Cell membrane; Single-pass type I membraneprotein Isoform EPOR-S: Secreted Note=Secreted and located to thecell surface Function (UniProt annotation) Receptor for erythropoietin Mediates erythropoietin-induced erythroblast proliferation and differentiation Upon EPOstimulation, EPOR dimerizes triggering the JAK2/STAT5 signalingcascade In some cell types, can also activate STAT1 and STAT3May also activate the LYN tyrosine kinase Isoform EPOR-T acts as a dominant-negative receptor ofEPOR-mediated signaling Catalytic Activity (UniProt annotation) N/A Protein Sequence MDHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFS
YQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESG
HVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPV
SLLTPSDLDPLILTLSLILVVILVLLTVLALLSHRRALKQKIWPGIPSPESEFEGLFTTHKGNFQLWLYQNDGCLWWSPC
TPFTEDPPASLEVLSERCWGTMQAVEPGTDDEGPLLEPVGSEHAQDTYLVLDKWLLPRNPPSEDLPGPGGSVDIVAMDEG
SEASSCSSALASKPSPEGASAASFEYTILDPSSQLLRPWTLCPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGL
SDGPYSNPYENSLIPAAEPLPPSYVACS
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
Pathway ID Pathway Name Pathway Description (KEGG) hsa04060 Cytokine-cytokine receptor interaction Cytokines are soluble extracellular proteins or glycoproteins that are crucial intercellular regulators and mobilizers of cells engaged in innate as well as adaptive inflammatory host defenses, cell growth, differentiation, cell death, angiogenesis, and development and repair processes aimed at the restoration of homeostasis. Cytokines are released by various cells in the body, usually in response to an activating stimulus, and they induce responses through binding to specific receptors on the cell surface of target cells. Cytokines can be grouped by structure into different families and their receptors can likewise be grouped. hsa04151 PI3K-Akt signaling pathway The phosphatidylinositol 3' -kinase(PI3K)-Akt signaling pathway is activated by many types of cellular stimuli or toxic insults and regulates fundamental cellular functions such as transcription, translation, proliferation, growth, and survival. The binding of growth factors to their receptor tyrosine kinase (RTK) or G protein-coupled receptors (GPCR) stimulates class Ia and Ib PI3K isoforms, respectively. PI3K catalyzes the production of phosphatidylinositol-3,4,5-triphosphate (PIP3) at the cell membrane. PIP3 in turn serves as a second messenger that helps to activate Akt. Once active, Akt can control key cellular processes by phosphorylating substrates involved in apoptosis, protein synthesis, metabolism, and cell cycle. hsa04630 Jak-STAT signaling pathway The Janus kinase/signal transducers and activators of transcription (JAK/STAT) pathway is one of a handful of pleiotropic cascades used to transduce a multitude of signals for development and homeostasis in animals, from humans to flies. In mammals, the JAK/STAT pathway is the principal signaling mechanism for a wide array of cytokines and growth factors. Following the binding of cytokines to their cognate receptor, STATs are activated by members of the JAK family of tyrosine kinases. Once activated, they dimerize and translocate to the nucleus and modulate the expression of target genes. In addition to the activation of STATs, JAKs mediate the recruitment of other molecules such as the MAP kinases, PI3 kinase etc. These molecules process downstream signals via the Ras-Raf-MAP kinase and PI3 kinase pathways which results in the activation of additional transcription factors. hsa04640 Hematopoietic cell lineage Blood-cell development progresses from a hematopoietic stem cell (HSC), which can undergo either self-renewal or differentiation into a multilineage committed progenitor cell: a common lymphoid progenitor (CLP) or a common myeloid progenitor (CMP). A CLP gives rise to the lymphoid lineage of white blood cells or leukocytes-the natural killer (NK) cells and the T and B lymphocytes. A CMP gives rise to the myeloid lineage, which comprises the rest of the leukocytes, the erythrocytes (red blood cells), and the megakaryocytes that produce platelets important in blood clotting. Cells undergoing these differentiation process express a stage- and lineage-specific set of surface markers. Therefore cellular stages are identified by the specific expression patterns of these genes. hsa05200 Pathways in cancer
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source BTRC Affinity Capture-Western physical 17327410 , (Europe PMC )NA BioGRID CBL Affinity Capture-Western physical 10374881 , (Europe PMC )NA BioGRID CISH Affinity Capture-Western, PCA, Reconstituted Complex, mammalian protein protein interaction trap physical, physical association 11781573 , 15644415 , 16961462 , 7796808 , (Europe PMC )0.37 BioGRID, IntAct, MINT CRKL Affinity Capture-Western, Reconstituted Complex physical 11443118 , 9129019 , 9344843 , (Europe PMC )NA BioGRID CUL2 Affinity Capture-Western physical 26846855 , (Europe PMC )NA BioGRID EGLN3 Affinity Capture-Western, Reconstituted Complex physical 26846855 , (Europe PMC )NA BioGRID ELOB Reconstituted Complex physical 26846855 , (Europe PMC )NA BioGRID ELOC Reconstituted Complex physical 26846855 , (Europe PMC )NA BioGRID EPO Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, microscale thermophoresis, surface plasmon resonance, x-ray crystallography direct interaction, physical 10318834 , 15358619 , 17327410 , 26481148 , 28514442 , 9774108 , 9808045 , (Europe PMC )0.44, 0.56 BioGRID, IntAct FBXW7 Synthetic Lethality genetic 26354767 , (Europe PMC )NA BioGRID GNAI1 Reconstituted Complex physical 12538595 , (Europe PMC )NA BioGRID GRAP Reconstituted Complex physical 8647802 , (Europe PMC )NA BioGRID GRB2 Affinity Capture-Western, Reconstituted Complex physical 7534299 , 8647802 , 9129019 , (Europe PMC )NA BioGRID INPP5D PCA, mammalian protein protein interaction trap, pull down association, physical, physical association 10660611 , 15644415 , (Europe PMC )0.55 BioGRID, IntAct, MINT IRS2 Affinity Capture-Western physical 9334184 , (Europe PMC )NA BioGRID JAK2 Affinity Capture-Western, Reconstituted Complex physical 11779507 , 14982882 , 8343951 , (Europe PMC )NA BioGRID LYN Affinity Capture-Western, Reconstituted Complex physical 9573010 , (Europe PMC )NA BioGRID MST1R Affinity Capture-Western physical 14982882 , (Europe PMC )NA BioGRID NOSIP Affinity Capture-Western physical 12746455 , (Europe PMC )NA BioGRID PIK3R1 Affinity Capture-Western, PCA, Reconstituted Complex physical 15644415 , 24113870 , 7559499 , 9162069 , (Europe PMC )NA BioGRID PLCG1 PCA physical 15644415 , (Europe PMC )NA BioGRID PTPN11 Affinity Capture-Western, Reconstituted Complex physical 7534299 , 8639815 , (Europe PMC )NA BioGRID PTPN6 Affinity Capture-Western, Reconstituted Complex, affinity chromatography technology, anti bait coimmunoprecipitation, experimental interaction detection, pull down association, direct interaction, physical, physical association 7228577 , 7528537 , 7528577 , 7889566 , (Europe PMC )0.80 BioGRID, IntAct, MINT RACK1 Reconstituted Complex physical 12960323 , (Europe PMC )NA BioGRID SH2B2 Reconstituted Complex physical 10374881 , (Europe PMC )NA BioGRID SHC1 Affinity Capture-Western physical 8400282 , (Europe PMC )NA BioGRID SOCS2 Affinity Capture-Western, PCA, Protein-peptide, Reconstituted Complex, Two-hybrid, mammalian protein protein interaction trap physical, physical association 11781573 , 15644415 , 16675548 , 16961462 , (Europe PMC )0.37 BioGRID, IntAct, MINT SOCS3 Affinity Capture-Western, Reconstituted Complex, pull down association, physical 10882725 , 12027890 , (Europe PMC )0.35 BioGRID, IntAct, MINT SRC Affinity Capture-Western physical 21075308 , (Europe PMC )NA BioGRID STAT5A Affinity Capture-Western, PCA, Reconstituted Complex physical 10374881 , 15644415 , 8977232 , (Europe PMC )NA BioGRID SYK Affinity Capture-Luminescence physical 9852052 , (Europe PMC )NA BioGRID VAV1 Affinity Capture-Western physical 9162069 , (Europe PMC )NA BioGRID VHL Affinity Capture-Western, Reconstituted Complex physical 26846855 , (Europe PMC )NA BioGRID
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CISH Affinity Capture-Western, PCA, Reconstituted Complex, mammalian protein protein interaction trap physical, physical association 11781573 , 15644415 , 16961462 , 7796808 , (Europe PMC )0.37 BioGRID, IntAct, MINT EPO Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, microscale thermophoresis, surface plasmon resonance, x-ray crystallography direct interaction, physical 10318834 , 15358619 , 17327410 , 26481148 , 28514442 , 9774108 , 9808045 , (Europe PMC )0.44, 0.56 BioGRID, IntAct EPOR fluorescence correlation spectroscopy, fluorescent resonance energy transfer direct interaction, physical association 16116438 , 21058338 , (Europe PMC )0.61 IntAct INPP5D PCA, mammalian protein protein interaction trap, pull down association, physical, physical association 10660611 , 15644415 , (Europe PMC )0.55 BioGRID, IntAct, MINT PLCG2 mammalian protein protein interaction trap physical association 15644415 , (Europe PMC )0.37 IntAct PTPN1 coimmunoprecipitation, phosphatase assay, pull down dephosphorylation reaction, physical association 14527337 , (Europe PMC )0.60 IntAct, MINT PTPN6 Affinity Capture-Western, Reconstituted Complex, affinity chromatography technology, anti bait coimmunoprecipitation, experimental interaction detection, pull down association, direct interaction, physical, physical association 7228577 , 7528537 , 7528577 , 7889566 , (Europe PMC )0.80 BioGRID, IntAct, MINT PTPRB phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct PTPRC phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct PTPRG phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct PTPRJ phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct PTPRO phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct SOCS2 Affinity Capture-Western, PCA, Protein-peptide, Reconstituted Complex, Two-hybrid, mammalian protein protein interaction trap physical, physical association 11781573 , 15644415 , 16675548 , 16961462 , (Europe PMC )0.37 BioGRID, IntAct, MINT SOCS3 Affinity Capture-Western, Reconstituted Complex, pull down association, physical 10882725 , 12027890 , (Europe PMC )0.35 BioGRID, IntAct, MINT
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source INPP5D PCA, mammalian protein protein interaction trap, pull down association, physical, physical association 10660611 , 15644415 , (Europe PMC )0.55 BioGRID, IntAct, MINT PTPN1 coimmunoprecipitation, phosphatase assay, pull down dephosphorylation reaction, physical association 14527337 , (Europe PMC )0.60 IntAct, MINT PTPN6 Affinity Capture-Western, Reconstituted Complex, affinity chromatography technology, anti bait coimmunoprecipitation, experimental interaction detection, pull down association, direct interaction, physical, physical association 7228577 , 7528537 , 7528577 , 7889566 , (Europe PMC )0.80 BioGRID, IntAct, MINT SOCS2 Affinity Capture-Western, PCA, Protein-peptide, Reconstituted Complex, Two-hybrid, mammalian protein protein interaction trap physical, physical association 11781573 , 15644415 , 16675548 , 16961462 , (Europe PMC )0.37 BioGRID, IntAct, MINT SOCS3 Affinity Capture-Western, Reconstituted Complex, pull down association, physical 10882725 , 12027890 , (Europe PMC )0.35 BioGRID, IntAct, MINT
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source BTRC Affinity Capture-Western physical 17327410 , (Europe PMC )NA BioGRID CBL Affinity Capture-Western physical 10374881 , (Europe PMC )NA BioGRID CISH Affinity Capture-Western, PCA, Reconstituted Complex, mammalian protein protein interaction trap physical, physical association 11781573 , 15644415 , 16961462 , 7796808 , (Europe PMC )0.37 BioGRID, IntAct, MINT CRKL Affinity Capture-Western, Reconstituted Complex physical 11443118 , 9129019 , 9344843 , (Europe PMC )NA BioGRID CUL2 Affinity Capture-Western physical 26846855 , (Europe PMC )NA BioGRID EGLN3 Affinity Capture-Western, Reconstituted Complex physical 26846855 , (Europe PMC )NA BioGRID ELOB Reconstituted Complex physical 26846855 , (Europe PMC )NA BioGRID ELOC Reconstituted Complex physical 26846855 , (Europe PMC )NA BioGRID EPO Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, microscale thermophoresis, surface plasmon resonance, x-ray crystallography direct interaction, physical 10318834 , 15358619 , 17327410 , 26481148 , 28514442 , 9774108 , 9808045 , (Europe PMC )0.44, 0.56 BioGRID, IntAct EPOR fluorescence correlation spectroscopy, fluorescent resonance energy transfer direct interaction, physical association 16116438 , 21058338 , (Europe PMC )0.61 IntAct FBXW7 Synthetic Lethality genetic 26354767 , (Europe PMC )NA BioGRID GNAI1 Reconstituted Complex physical 12538595 , (Europe PMC )NA BioGRID GRAP Reconstituted Complex physical 8647802 , (Europe PMC )NA BioGRID GRB2 Affinity Capture-Western, Reconstituted Complex physical 7534299 , 8647802 , 9129019 , (Europe PMC )NA BioGRID INPP5D PCA, mammalian protein protein interaction trap, pull down association, physical, physical association 10660611 , 15644415 , (Europe PMC )0.55 BioGRID, IntAct, MINT IRS2 Affinity Capture-Western physical 9334184 , (Europe PMC )NA BioGRID JAK2 Affinity Capture-Western, Reconstituted Complex physical 11779507 , 14982882 , 8343951 , (Europe PMC )NA BioGRID LYN Affinity Capture-Western, Reconstituted Complex physical 9573010 , (Europe PMC )NA BioGRID MST1R Affinity Capture-Western physical 14982882 , (Europe PMC )NA BioGRID NOSIP Affinity Capture-Western physical 12746455 , (Europe PMC )NA BioGRID PIK3R1 Affinity Capture-Western, PCA, Reconstituted Complex physical 15644415 , 24113870 , 7559499 , 9162069 , (Europe PMC )NA BioGRID PLCG1 PCA physical 15644415 , (Europe PMC )NA BioGRID PLCG2 mammalian protein protein interaction trap physical association 15644415 , (Europe PMC )0.37 IntAct PTPN1 coimmunoprecipitation, phosphatase assay, pull down dephosphorylation reaction, physical association 14527337 , (Europe PMC )0.60 IntAct, MINT PTPN11 Affinity Capture-Western, Reconstituted Complex physical 7534299 , 8639815 , (Europe PMC )NA BioGRID PTPN6 Affinity Capture-Western, Reconstituted Complex, affinity chromatography technology, anti bait coimmunoprecipitation, experimental interaction detection, pull down association, direct interaction, physical, physical association 7228577 , 7528537 , 7528577 , 7889566 , (Europe PMC )0.80 BioGRID, IntAct, MINT PTPRB phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct PTPRC phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct PTPRG phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct PTPRJ phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct PTPRO phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct RACK1 Reconstituted Complex physical 12960323 , (Europe PMC )NA BioGRID SH2B2 Reconstituted Complex physical 10374881 , (Europe PMC )NA BioGRID SHC1 Affinity Capture-Western physical 8400282 , (Europe PMC )NA BioGRID SOCS2 Affinity Capture-Western, PCA, Protein-peptide, Reconstituted Complex, Two-hybrid, mammalian protein protein interaction trap physical, physical association 11781573 , 15644415 , 16675548 , 16961462 , (Europe PMC )0.37 BioGRID, IntAct, MINT SOCS3 Affinity Capture-Western, Reconstituted Complex, pull down association, physical 10882725 , 12027890 , (Europe PMC )0.35 BioGRID, IntAct, MINT SRC Affinity Capture-Western physical 21075308 , (Europe PMC )NA BioGRID STAT5A Affinity Capture-Western, PCA, Reconstituted Complex physical 10374881 , 15644415 , 8977232 , (Europe PMC )NA BioGRID SYK Affinity Capture-Luminescence physical 9852052 , (Europe PMC )NA BioGRID VAV1 Affinity Capture-Western physical 9162069 , (Europe PMC )NA BioGRID VHL Affinity Capture-Western, Reconstituted Complex physical 26846855 , (Europe PMC )NA BioGRID
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
JAK2 Y368_SEHAQDTyLVLDKWL , Y426_ASAASFEyTILDPSS , Y454_PTPPHLKyLYLVVSD , Y456_PPHLKYLyLVVSDSG , Y468_DSGISTDySSGDSQG , Y485_GGLSDGPySNPYENS , Y489_DGPYSNPyENSLIPA , Y504_AEPLPPSyVACS , LTP, in vitro, in vivo 10579919 , 12441334 ,(Europe PMC )HPRD, PhosphoELM , Lyn Y368_SEHAQDTyLVLDKWL , LTP 10579919 ,(Europe PMC )PhosphoELM , Unknown Y426_ASAASFEyTILDPSS , Y454_PTPPHLKyLYLVVSD , Y456_PPHLKYLyLVVSDSG , Y489_DGPYSNPyENSLIPA , Y504_AEPLPPSyVACS , LTP 10579919 , 10660611 , 11443118 , 12027890 , 12441334 , 7559499 , 9573010 ,(Europe PMC )PhosphoELM ,
Statistics
