Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
ELF1
Gene Name  | ELF1 (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: NA |
| Synonyms | ELF1 | |
| Protein Name | ELF1 | |
| Alternative Name(s) | ETS-related transcription factor Elf-1;E74-like factor 1; | |
| Protein Family | Belongs to the ETS family | |
| EntrezGene ID | 1997 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P32519 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 67498 Dalton | |
| Protein Length | 619 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000120690 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - KOG3804 | eggNOG - ENOG4111K4J | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Nucleus | |||
| Function (UniProt annotation) | |||
| Transcription factor that activates the LYN and BLKpromoters Appears to be required for the T-cell-receptor-mediatedtrans activation of HIV-2 gene expression Binds specifically totwo purine-rich motifs in the HIV-2 enhancer | |||
| Catalytic Activity (UniProt annotation) | |||
| N/A | |||
| Protein Sequence | |||
| MAAVVQQNDLVFEFASNVMEDERQLGDPAIFPAVIVEHVPGADILNSYAGLACVEEPNDMITESSLDVAEEEIIDDDDDD ITLTVEASCHDGDETIETIEAAEALLNMDSPGPMLDEKRINNNIFSSPEDDMVVAPVTHVSVTLDGIPEVMETQQVQEKY ADSPGASSPEQPKRKKGRKTKPPRPDSPATTPNISVKKKNKDGKGNTIYLWEFLLALLQDKATCPKYIKWTQREKGIFKL VDSKAVSRLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQFKEMPKDLIYINDEDPSSSIESSDPSLSSSAT SNRNQTSRSRVSSSPGVKGGATTVLKPGNSKAAKPKDPVEVAQPSEVLRTVQPTQSPYPTQLFRTVHVVQPVQAVPEGEA ARTSTMQDETLNSSVQSIRTIQAPTQVPVVVSPRNQQLHTVTLQTVPLTTVIASTDPSAGTGSQKFILQAIPSSQPMTVL KENVMLQSQKAGSPPSIVLGPAQVQQVLTSNVQTICNGTVSVASSPSFSATAPVVTFSPRSSQLVAHPPGTVITSVIKTQ ETKTLTQEVEKKESEDHLKENTEKTEQQPQPYVMVVSSSNGFTSQVAMKQNELLEPNSF | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000978 | F:RNA polymerase II proximal promoter sequence-specific DNA binding |
| GO:0000981 | F:RNA polymerase II transcription factor activity |
| GO:0001077 | sequence-specific DNA binding |
| GO:0001817 | F:transcriptional activator activity |
| GO:0001959 | RNA polymerase II proximal promoter sequence-specific DNA binding |
| GO:0003700 | P:regulation of cytokine production |
| GO:0005634 | P:regulation of cytokine-mediated signaling pathway |
| GO:0005654 | F:DNA-binding transcription factor activity |
| GO:0030154 | C:nucleus |
| GO:0045893 | C:nucleoplasm |
| GO:0045944 | P:cell differentiation |
| GO:0050855 | P:positive regulation of transcription |
| GO:0050860 | DNA-templated |
