- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
CDC37
Gene Name  | CDC37 (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: 5FWM |
| Synonyms | CDC37, CDC37A | |
| Protein Name | CDC37 | |
| Alternative Name(s) | Hsp90 co-chaperone Cdc37;Hsp90 chaperone protein kinase-targeting subunit;p50Cdc37;Hsp90 co-chaperone Cdc37, N-terminally processed; | |
| Protein Family | Belongs to the CDC37 family | |
| EntrezGene ID | 11140 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q16543 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 44468 Dalton | |
| Protein Length | 378 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000105401 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - KOG2260 | eggNOG - ENOG410XTCZ | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm | |||
| Function (UniProt annotation) | |||
| Co-chaperone that binds to numerous kinases and promotestheir interaction with the Hsp90 complex, resulting instabilization and promotion of their activity (PubMed:8666233)Inhibits HSP90AA1 ATPase activity (PubMed:23569206) | |||
| Catalytic Activity (UniProt annotation) | |||
| N/A | |||
| Protein Sequence | |||
| MVDYSVWDHIEVSDDEDETHPNIDTASLFRWRHQARVERMEQFQKEKEELDRGCRECKRKVAECQRKLKELEVAEGGKAE LERLQAEAQQLRKEERSWEQKLEEMRKKEKSMPWNVDTLSKDGFSKSMVNTKPEKTEEDSEEVREQKHKTFVEKYEKQIK HFGMLRRWDDSQKYLSDNVHLVCEETANYLVIWCIDLEVEEKCALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTK IKTADRQYMEGFNDELEAFKERVRGRAKLRIEKAMKEYEEEERKKRLGPGGLDPVEVYESLPEELQKCFDVKDVQMLQDA ISKMDPTDAKYHMQRCIDSGLWVPNSKASEAKEGEEAGPGDPLLEAVPKTGDEKDVSV | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000079 | P:regulation of cyclin-dependent protein serine/threonine kinase activity |
| GO:0004713 | F:protein tyrosine kinase activity |
| GO:0005737 | C:cytoplasm |
| GO:0005829 | C:cytosol |
| GO:0006457 | P:protein folding |
| GO:0006605 | P:protein targeting |
| GO:0010608 | P:posttranscriptional regulation of gene expression |
| GO:0019887 | F:protein kinase regulator activity |
| GO:0019900 | F:kinase binding |
| GO:0019901 | F:protein kinase binding |
| GO:0031072 | F:heat shock protein binding |
| GO:0038128 | P:ERBB2 signaling pathway |
| GO:0050821 | P:protein stabilization |
| GO:0051082 | F:unfolded protein binding |
| GO:0051087 | F:chaperone binding |
| GO:0051879 | F:Hsp90 protein binding |
| GO:0060334 | P:regulation of interferon-gamma-mediated signaling pathway |
| GO:0060338 | P:regulation of type I interferon-mediated signaling pathway |
| GO:0070062 | C:extracellular exosome |
| GO:0097110 | F:scaffold protein binding |
| GO:0098779 | P:positive regulation of mitophagy in response to mitochondrial depolarization |
| GO:0101031 | C:chaperone complex |
| GO:1990565 | C:HSP90-CDC37 chaperone complex |
CDC37 is dephosphorylated by following phosphatases:
| Phosphatase Gene Name | Phosphatase UniProt_AC | DephosphoSite and sequence (+/-5) in CDC37 (Q16543) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| PPP5C | P53041 | Ser-13_DHIEVsDDEDE, | In vitro and in vivo | 18922470, | Europe PMC |  |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| hsa04151 | PI3K-Akt signaling pathway | The phosphatidylinositol 3' -kinase(PI3K)-Akt signaling pathway is activated by many types of cellular stimuli or toxic insults and regulates fundamental cellular functions such as transcription, translation, proliferation, growth, and survival. The binding of growth factors to their receptor tyrosine kinase (RTK) or G protein-coupled receptors (GPCR) stimulates class Ia and Ib PI3K isoforms, respectively. PI3K catalyzes the production of phosphatidylinositol-3,4,5-triphosphate (PIP3) at the cell membrane. PIP3 in turn serves as a second messenger that helps to activate Akt. Once active, Akt can control key cellular processes by phosphorylating substrates involved in apoptosis, protein synthesis, metabolism, and cell cycle. |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-1227986 | Signaling by ERBB2. | ERBB2, also known as HER2 or NEU, is a receptor tyrosine kinase (RTK) belonging to the EGFR family. ERBB2 possesses an extracellular domain that does not bind any known ligand, contrary to other EGFR family members, a single transmembrane domain, and an intracellular domain consisting of an active kinase and a C-tail with multiple tyrosine phosphorylation sites. Inactive ERBB2 is associated with a chaperone heat shock protein 90 (HSP90) and its co-chaperone CDC37 (Xu et al. 2001, Citri et al. 2004, Xu et al. 2005). In addition, ERBB2 is associated with ERBB2IP (also known as ERBIN or LAP2), a protein responsible for proper localization of ERBB2. In epithelial cells, ERBB2IP restricts expression of ERBB2 to basolateral plasma membrane regions (Borg et al. 2000).\nERBB2 becomes activated by forming a heterodimer with another ligand-activated EGFR family member, either EGFR, ERBB3 or ERBB4, which is accompanied by dissociation of chaperoning proteins HSP90 and CDC37 (Citri et al. 2004), as well as ERBB2IP (Borg et al. 2000) from ERBB2. ERBB2 heterodimers function to promote cell proliferation, cell survival and differentiation, depending on the cellular context. ERBB2 can also be activated by homodimerization when it is overexpressed, in cancer for example. \nIn cells expressing both ERBB2 and EGFR, EGF stimulation of EGFR leads to formation of both ERBB2:EGFR heterodimers (Wada et al. 1990, Karunagaran et al. 1996) and EGFR homodimers. Heterodimers of ERBB2 and EGFR trans-autophosphorylate on twelve tyrosine residues, six in the C-tail of EGFR and six in the C-tail of ERBB2 - Y1023, Y1139, Y1196, Y1221, Y1222 and Y1248 (Margolis et al. 1989, Hazan et al. 1990,Walton et al. 1990, Helin et al. 1991, Ricci et al. 1995, Pinkas-Kramarski 1996). Phosphorylated tyrosine residues in the C-tail of EGFR and ERBB2 serve as docking sites for downstream signaling molecules. Three key signaling pathways activated by ERBB2:EGFR heterodimers are RAF/MAP kinase cascade, PI3K-induced AKT signaling, and signaling by phospholipase C gamma (PLCG1). Downregulation of EGFR signaling is mediated by ubiquitin ligase CBL, and is shown under Signaling by EGFR.\nIn cells expressing ERBB2 and ERBB3, ERBB3 activated by neuregulin NRG1 or NRG2 binding (Tzahar et al. 1994) forms a heterodimer with ERBB2 (Pinkas-Kramarski et al. 1996, Citri et al. 2004). ERBB3 is the only EGFR family member with no kinase activity, and can only function in heterodimers, with ERBB2 being its preferred heterodimerization partner. After heterodimerization, ERBB2 phosphorylates ten tyrosine residues in the C-tail of ERBB3, Y1054, Y1197, Y1199, Y1222, Y1224, Y1260, Y1262, Y1276, Y1289 and Y1328 (Prigent et al. 1994, Pinkas-Kramarski et al. 1996, Vijapurkar et al. 2003, Li et al. 2007) that subsequently serve as docking sites for downstream signaling molecules, resulting in activation of PI3K-induced AKT signaling and RAF/MAP kinase cascade. Signaling by ERBB3 is downregulated by the action of RNF41 ubiquitin ligase, also known as NRDP1. \nIn cells expressing ERBB2 and ERBB4, ligand stimulated ERBB4 can either homodimerize or form heterodimers with ERBB2 (Li et al. 2007), resulting in trans-autophosphorylation of ERBB2 and ERBB4 on C-tail tyrosine residues that will subsequently serve as docking sites for downstream signaling molecules, leading to activation of RAF/MAP kinase cascade and, in the case of ERBB4 CYT1 isoforms, PI3K-induced AKT signaling (Hazan et al. 1990, Cohen et al. 1996, Li et al. 2007, Kaushansky et al. 2008). Signaling by ERBB4 is downregulated by the action of WWP1 and ITCH ubiquitin ligases, and is shown under Signaling by ERBB4 |
| R-HSA-1236382 | Constitutive Signaling by Ligand-Responsive EGFR Cancer Variants. | Signaling by EGFR is frequently activated in cancer through activating mutations in the coding sequence of the EGFR gene, resulting in expression of a constitutively active mutant protein. Epidermal growth factor receptor kinase domain mutants are present in ~16% of non-small-cell lung cancers (NSCLCs), but are also found in other cancer types, such as breast cancer, colorectal cancer, ovarian cancer and thyroid cancer. EGFR kinase domain mutants harbor activating mutations in exons 18-21 which code for the kinase domain (amino acids 712-979) . Small deletions, insertions or substitutions of amino acids within the kinase domain lock EGFR in its active conformation in which the enzyme can dimerize and undergo autophosphorylation spontaneously, without ligand binding (although ligand binding ability is preserved), and activate downstream signaling pathways that promote cell survival (Greulich et al. 2005, Zhang et al. 2006, Yun et al. 2007, Red Brewer et al. 2009). Point mutations in the extracellular domain of EGFR are frequently found in glioblastoma. Similar to kinase domain mutations, point mutations in the extracellular domain result in constitutively active EGFR proteins that signal in the absence of ligands, but ligand binding ability and responsiveness are preserved (Lee et al. 2006). EGFR kinase domain mutants need to maintain association with the chaperone heat shock protein 90 (HSP90) for proper functioning (Shimamura et al. 2005, Lavictoire et al. 2003). CDC37 is a co-chaperone of HSP90 that acts as a scaffold and regulator of interaction between HSP90 and its protein kinase clients. CDC37 is frequently over-expressed in cancers involving mutant kinases and acts as an oncogene (Roe et al. 2004, reviewed by Gray Jr. et al. 2008). Over-expression of the wild-type EGFR or EGFR cancer mutants results in aberrant activation of downstream signaling cascades, namely RAS/RAF/MAP kinase signaling and PI3K/AKT signaling, and possibly signaling by PLCG1, which leads to increased cell proliferation and survival, providing selective advantage to cancer cells that harbor activating mutations in the EGFR gene (Sordella et al. 2004, Huang et al. 2007). While growth factor activated wild-type EGFR is promptly down-regulated by internalization and degradation, cancer mutants of EGFR demonstrate prolonged activation (Lynch et al. 2004). Association of HSP90 with EGFR kinase domain mutants negatively affects CBL-mediated ubiquitination, possibly through decreasing the affinity of EGFR kinase domain mutants for phosphorylated CBL, so that CBL dissociates from the complex upon phosphorylation and cannot perform ubiquitination (Yang et al. 2006, Padron et al. 2007). Various molecular therapeutics are being developed to target aberrantly activated EGFR in cancer. Non-covalent (reversible) small tyrosine kinase inhibitors (TKIs), such as gefitinib and erlotinib, selectively bind kinase domain of EGFR, competitively inhibiting ATP binding and subsequent autophosphorylation of EGFR dimers. EGFR kinase domain mutants sensitive to non-covalent TKIs exhibit greater affinity for TKIs than ATP compared with the wild-type EGFR protein, and are therefore preferential targets of non-covalent TKI therapeutics (Yun et al. 2007). EGFR proteins that harbor point mutations in the extracellular domain also show sensitivity to non-covalent tyrosine kinase inhibitors (Lee et al. 2006). EGFR kinase domain mutants harboring small insertions in exon 20 or a secondary T790M mutation are resistant to reversible TKIs (Balak et al. 2006) due to increased affinity for ATP (Yun et al. 2008), and are targets of covalent (irreversible) TKIs that form a covalent bond with EGFR cysteine residue C397. However, effective concentrations of covalent TKIs also inhibit wild-type EGFR, causing severe side effects (Zhou et al. 2009). Hence, covalent TKIs have not shown much promise in clinical trials (Reviewed by Pao and Chmielecki in 2010) |
| R-HSA-5637810 | Constitutive Signaling by EGFRvIII. | In glioblastoma, the most prevalent EGFR mutation, present in ~25% of tumors, is the deletion of the ligand binding domain of EGFR, accompanied with amplification of the mutated allele, which results in over-expression of the mutant protein known as EGFRvIII. EGFRvIII mutant is not able to bind a ligand, but dimerizes and autophosphorylates spontaneously and is therefore constitutively active (Fernandes et al. 2001). Point mutations in the extracellular domain of EGFR are also frequently found in glioblastoma, but ligand binding ability and responsiveness are preserved (Lee et al. 2006). Similar to EGFR kinase domain mutants, EGFRvIII mutant needs to maintain association with the chaperone heat shock protein 90 (HSP90) for proper functioning (Shimamura et al. 2005, Lavictoire et al. 2003). CDC37 is a co-chaperone of HSP90 that acts as a scaffold and regulator of interaction between HSP90 and its protein kinase clients. CDC37 is frequently over-expressed in cancers involving mutant kinases and acts as an oncogene (Roe et al. 2004, reviewed by Gray Jr. et al. 2008). Expression of EGFRvIII mutant results in aberrant activation of downstream signaling cascades, namely RAS/RAF/MAP kinase signaling and PI3K/AKT signaling, and possibly signaling by PLCG1, which leads to increased cell proliferation and survival, providing selective advantage to cancer cells that harbor EGFRvIII (Huang et al. 2007). EGFRvIII mutant does not autophosorylate on the tyrosine residue Y1045, a docking site for CBL, and is therefore unable to recruit CBL ubiquitin ligase, which enables it to escape degradation (Han et al |
| R-HSA-8863795 | Downregulation of ERBB2 signaling. | Signaling by ERBB2 can be downregulated by ubiquitination and subsequent proteasome-dependent degradation of ERBB2 or activated ERBB2 heterodimers. In addition, protein tyrosine phosphatases that dephosphorylate tyrosine residues in the C-terminus of ERBB2 prevent the recruitment of adapter proteins involved in signal transduction, thus attenuating ERBB2 signaling.STUB1 (CHIP) and CUL5 are E3 ubiquitin ligases that can target non-activated ERBB2 for proteasome-dependent degradation (Xu et al. 2002, Ehrlich et al. 2009). RNF41 (NRDP1) is an E3 ubiquitin ligase that targets ERBB3 and activated heterodimers of ERBB2 and ERBB3 for proteasome-dependent degradation by ubiquitinating ERBB3 (Cao et al. 2007).Two protein tyrosine phosphatases of the PEST family, PTPN12 and PTPN18, dephosphorylate tyrosine residues in the C-terminus of ERBB2, thus preventing signal transduction to RAS and PI3K effectors (Sun et al. 2011, Wang et al. 2014) |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ABL2 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AHCYL1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| AHSA1 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AIP | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AKT1 | Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation | association, physical, physical association | 12176997, 22504172, 24869908, (Europe PMC) | 0.50 | BioGRID, IntAct |
| AKT3 | Affinity Capture-MS, coimmunoprecipitation, luminescence based mammalian interactome mapping | physical, physical association | 12176997, 25036637, 28514442, (Europe PMC) | 0.59 | BioGRID, IntAct |
| APOE | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, two hybrid array | association, physical, physical association | 21163940, (Europe PMC) | 0.48 | BioGRID, IntAct |
| APP | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| AR | Reconstituted Complex | physical | 11085988, (Europe PMC) | NA | BioGRID |
| ARAF | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 24189400, 25036637, (Europe PMC) | 0.53 | BioGRID, IntAct |
| ATG101 | Affinity Capture-MS | physical | 20562859, (Europe PMC) | NA | BioGRID |
| AURKA | Affinity Capture-MS | physical | 23443559, (Europe PMC) | NA | BioGRID |
| AURKB | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping, proximity-dependent biotin identification, pull down | association, physical, physical association | 25036637, 26186194, 29568061, (Europe PMC) | 0.66 | BioGRID, IntAct |
| AURKC | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| BRAF | Affinity Capture-MS, tandem affinity purification | association, physical | 17979178, 27034005, (Europe PMC) | 0.35 | BioGRID, IntAct |
| BRCA1 | Affinity Capture-MS | physical | 26831064, (Europe PMC) | NA | BioGRID |
| BTBD10 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| BTK | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| C19orf44 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CC2D1A | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CDC25C | Affinity Capture-MS, Affinity Capture-Western, pull down | association, physical | 17525741, 27432908, 28330616, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDC37 | Affinity Capture-MS, Co-fractionation, PCA, Reconstituted Complex | physical | 11916974, 21675959, 24189400, (Europe PMC) | NA | BioGRID |
| CDC37L1 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDCA5 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDK1 | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 17525741, 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDK11A | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 24189400, 25036637, 28514442, (Europe PMC) | 0.53 | BioGRID, IntAct |
| CDK11B | Affinity Capture-MS, Affinity Capture-Western, tandem affinity purification | association, physical | 15344906, 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDK13 | Affinity Capture-MS, luminescence based mammalian interactome mapping | physical, physical association | 25036637, 26186194, (Europe PMC) | 0.40 | BioGRID, IntAct |
| CDK15 | Affinity Capture-MS, luminescence based mammalian interactome mapping | physical, physical association | 25036637, 26186194, (Europe PMC) | 0.40 | BioGRID, IntAct |
| CDK18 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| CDK4 | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, PCA, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, electron tomography, molecular sieving, tandem affinity purification, two hybrid | association, physical, physical association | 11867521, 17353931, 21675959, 21871133, 24189400, 25036637, 26186194, 27339980, 28514442, 8666233, 8703009, 9150368, (Europe PMC) | 0.89 | BioGRID, IntAct |
| CDK5 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CDK6 | Reconstituted Complex, coimmunoprecipitation, luminescence based mammalian interactome mapping, two hybrid | physical, physical association | 25036637, 8666233, 9150368, (Europe PMC) | 0.65 | BioGRID, IntAct |
| CDK7 | Affinity Capture-MS, Reconstituted Complex, proximity-dependent biotin identification, pull down | association, physical | 26186194, 29568061, 8666233, (Europe PMC) | 0.46 | BioGRID, IntAct |
| CDK9 | Affinity Capture-MS, luminescence based mammalian interactome mapping, tandem affinity purification | association, physical, physical association | 20305087, 23455922, 24189400, 25036637, 26186194, 28514442, (Europe PMC) | 0.67 | BioGRID, IntAct |
| CDKL1 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| CDKL2 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| CEP104 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CFTR | Affinity Capture-MS | physical | 26618866, (Europe PMC) | NA | BioGRID |
| CHGA | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CHORDC1 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CHUK | Affinity Capture-Luminescence, Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation, tandem affinity purification | association, physical, physical association | 11864612, 14743216, 21903422, 24189400, 25036637, (Europe PMC) | 0.74 | BioGRID, IntAct |
| CKS1B | Reconstituted Complex | physical | 19786724, (Europe PMC) | NA | BioGRID |
| CKS2 | Reconstituted Complex | physical | 19786724, (Europe PMC) | NA | BioGRID |
| CLK3 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CPLANE2 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| CRYM | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CTTN | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 24189400, 25036637, (Europe PMC) | 0.53 | BioGRID, IntAct |
| CYLD | Affinity Capture-MS | physical | 27591049, (Europe PMC) | NA | BioGRID |
| CYP2C9 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| DCTN1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| DDR1 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DDX17 | Affinity Capture-Luminescence, Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DDX5 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DEAF1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| DLD | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DMWD | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| DNAJB1 | Affinity Capture-Luminescence, Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, two hybrid array | association, physical, physical association | 21163940, 25036637, (Europe PMC) | 0.55 | BioGRID, IntAct |
| DNAJC7 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DNM1L | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ECSIT | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EDEM3 | Affinity Capture-MS | physical | 28366632, (Europe PMC) | NA | BioGRID |
| EEF1A1 | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| EEF1A1P5 | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| EEF1A2 | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| EGFR | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, luminescence based mammalian interactome mapping, tandem affinity purification | association, physical, physical association | 12471035, 23956138, 24189400, 25036637, (Europe PMC) | 0.62 | BioGRID, IntAct |
| EIF2AK1 | Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation | association, physical | 11036079, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EIF2AK2 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EIF2S1 | Reconstituted Complex | physical | 12930845, (Europe PMC) | NA | BioGRID |
| EIF3B | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| ELAVL3 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EMD | Affinity Capture-MS | physical | 17620012, (Europe PMC) | NA | BioGRID |
| ERBB2 | Affinity Capture-MS, luminescence based mammalian interactome mapping, tandem affinity purification | association, physical, physical association | 24189400, 25036637, (Europe PMC) | 0.56 | BioGRID, IntAct |
| ERBB3 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ESRRB | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| EVC2 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EWSR1 | Proximity Label-MS | physical | 24999758, (Europe PMC) | NA | BioGRID |
| EXOSC1 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FBXL12 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FBXO6 | Affinity Capture-MS | physical | 22268729, (Europe PMC) | NA | BioGRID |
| FBXW4 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FER | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping | association, physical, physical association | 25036637, (Europe PMC) | 0.50 | BioGRID, IntAct |
| FGFR3 | Affinity Capture-MS, Affinity Capture-Western, luminescence based mammalian interactome mapping | physical, physical association | 21487019, 25036637, (Europe PMC) | 0.40 | BioGRID, IntAct |
| FKBP4 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping | association, physical, physical association | 25036637, (Europe PMC) | 0.50 | BioGRID, IntAct |
| FKBP5 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FKBP6 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FKBPL | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FLCN | Affinity Capture-Western | physical | 27353360, (Europe PMC) | NA | BioGRID |
| FNIP1 | Affinity Capture-Western | physical | 27353360, (Europe PMC) | NA | BioGRID |
| FNIP2 | Affinity Capture-Western | physical | 27353360, (Europe PMC) | NA | BioGRID |
| FTSJ1 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| FYN | Affinity Capture-MS, luminescence based mammalian interactome mapping | physical, physical association | 25036637, 28514442, (Europe PMC) | 0.40 | BioGRID, IntAct |
| GCDH | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GCH1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| GFAP | Affinity Capture-MS, two hybrid array, two hybrid prey pooling approach | physical, physical association | 24189400, (Europe PMC) | 0.49 | BioGRID, IntAct |
| GLMN | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GRK5 | Affinity Capture-MS | physical | 22952844, (Europe PMC) | NA | BioGRID |
| HCK | Affinity Capture-Western | physical | 11413142, (Europe PMC) | NA | BioGRID |
| HNRNPM | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HSP90AA1 | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, luminescence based mammalian interactome mapping, tandem affinity purification | association, physical, physical association | 11413142, 12176997, 12930845, 14718169, 15001580, 15647277, 19875381, 20159553, 21360678, 21871133, 22315411, 22504172, 22729780, 22939624, 24189400, 24462205, 25036637, 25486457, 26496610, 26804907, 27353360, 9685350, (Europe PMC) | 0.35, 0.89 | BioGRID, IntAct |
| HSP90AB1 | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, electron tomography, luminescence based mammalian interactome mapping, molecular sieving, tandem affinity purification | association, physical, physical association | 11036079, 22939624, 23428871, 24189400, 25036637, 25486457, 26496610, 27339980, 28215707, (Europe PMC) | 0.89 | BioGRID, IntAct |
| HSPA1A | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| HSPA5 | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| HSPA8 | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| IFIT3 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, pull down, two hybrid array | association, direct interaction, physical, physical association | 21163940, (Europe PMC) | 0.58 | BioGRID, IntAct |
| IFIT5 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| IKBKB | Affinity Capture-Luminescence, Affinity Capture-MS, Co-purification, Reconstituted Complex, anti tag coimmunoprecipitation, tandem affinity purification | association, physical, physical association | 11864612, 14743216, 21903422, 25036637, 26496610, (Europe PMC) | 0.74 | BioGRID, IntAct |
| IKBKE | Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping, tandem affinity purification | association, physical, physical association | 14743216, 17353931, 21903422, 25036637, (Europe PMC) | 0.77 | BioGRID, IntAct |
| IKBKG | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification | association, physical, physical association | 11864612, 14743216, 24189400, 24618592, 25036637, 26496610, (Europe PMC) | 0.80 | BioGRID, IntAct |
| IMMT | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| IRAK1 | Affinity Capture-Western, Co-fractionation | physical | 15647277, (Europe PMC) | NA | BioGRID |
| IRAK2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ITK | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| KEAP1 | Affinity Capture-MS | physical | 27621311, (Europe PMC) | NA | BioGRID |
| LONP1 | Two-hybrid | physical | 21163940, (Europe PMC) | NA | BioGRID |
| LOXL4 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| LRRK1 | Affinity Capture-MS | physical | 20697350, (Europe PMC) | NA | BioGRID |
| LRRK2 | Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology, anti tag coimmunoprecipitation, tandem affinity purification | association, physical, physical association | 16321986, 18367605, 20642453, 22612223, 23075850, 26355680, (Europe PMC) | 0.85 | BioGRID, IntAct |
| LUC7L2 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| MAP2K5 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| MAP3K1 | Affinity Capture-MS, tandem affinity purification | physical, physical association | 14743216, (Europe PMC) | 0.40 | BioGRID, IntAct |
| MAP3K11 | Affinity Capture-MS, Affinity Capture-Western | physical | 15001580, (Europe PMC) | NA | BioGRID |
| MAP3K3 | Affinity Capture-MS, tandem affinity purification | physical, physical association | 14743216, (Europe PMC) | 0.40 | BioGRID, IntAct |
| MAP3K6 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| MAP3K7 | Affinity Capture-Western, anti bait coimmunoprecipitation, pull down, tandem affinity purification | association, physical, physical association | 14743216, 19026643, (Europe PMC) | 0.62 | BioGRID, IntAct, MINT |
| MAPK7 | Affinity Capture-Western, luminescence based mammalian interactome mapping | physical, physical association | 23428871, 25036637, (Europe PMC) | 0.40 | BioGRID, IntAct |
| MASP1 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MOV10 | Affinity Capture-RNA | physical | 22658674, (Europe PMC) | NA | BioGRID |
| MTOR | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| MYLK4 | Affinity Capture-MS, luminescence based mammalian interactome mapping | physical, physical association | 25036637, 26186194, (Europe PMC) | 0.40 | BioGRID, IntAct |
| MZT2B | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| NCOA5 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| NEK6 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| NEK8 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NOS3 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, pull down, two hybrid array | association, direct interaction, physical, physical association | 21163940, (Europe PMC) | 0.58 | BioGRID, IntAct |
| NPM1 | Affinity Capture-MS | physical | 23402259, (Europe PMC) | NA | BioGRID |
| NTRK1 | Affinity Capture-MS, Affinity Capture-Western | physical | 20663926, 25921289, (Europe PMC) | NA | BioGRID |
| NUP98 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NXF1 | Affinity Capture-RNA | physical | 22658674, (Europe PMC) | NA | BioGRID |
| OFD1 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| OGA | Co-fractionation, Two-hybrid | physical | 21163940, 22863883, 26344197, (Europe PMC) | NA | BioGRID |
| OGFR | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| PANX1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PATL1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PCBP1 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| PDIK1L | Affinity Capture-MS, luminescence based mammalian interactome mapping | physical, physical association | 25036637, 28514442, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PDZK1 | Affinity Capture-Western | physical | 24869908, (Europe PMC) | NA | BioGRID |
| PINK1 | Affinity Capture-MS, Affinity Capture-Western, luminescence based mammalian interactome mapping | physical, physical association | 18003639, 18359116, 21151955, 25036637, 28438176, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PKM | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| POC1B | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PPHLN1 | Two-hybrid | physical | 21900206, (Europe PMC) | NA | BioGRID |
| PPID | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PPP5C | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, pull down | association, physical, physical association | 21360678, 25036637, 28330616, (Europe PMC) | 0.71 | BioGRID, IntAct |
| PPP6R3 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| PRAM1 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PRDX2 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PRKAA1 | Affinity Capture-MS, luminescence based mammalian interactome mapping, tandem affinity purification | association, physical, physical association | 16306228, 25036637, (Europe PMC) | 0.35, 0.40 | BioGRID, IntAct |
| PRKCI | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 14676191, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PRMT1 | Two-hybrid | physical | 21900206, (Europe PMC) | NA | BioGRID |
| PRPF4 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSEN1 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, two hybrid array | association, physical, physical association | 21163940, (Europe PMC) | 0.48 | BioGRID, IntAct |
| PSKH2 | Affinity Capture-MS, luminescence based mammalian interactome mapping | physical, physical association | 25036637, 26186194, 28514442, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PSME1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PTGES3 | Reconstituted Complex | physical | 22504172, (Europe PMC) | NA | BioGRID |
| RAD23A | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RAE1 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RAF1 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping, tandem affinity purification | association, physical, physical association | 17979178, 24189400, 25036637, (Europe PMC) | 0.71 | BioGRID, IntAct |
| RASSF3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 24366813, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RHOBTB2 | Affinity Capture-MS | physical | 24608665, (Europe PMC) | NA | BioGRID |
| RIPK3 | Affinity Capture-MS, tandem affinity purification | physical, physical association | 14743216, 21903422, (Europe PMC) | 0.40 | BioGRID, IntAct |
| RNF32 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RPAP3 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPS15A | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| RPS2 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPS27 | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| RPS27L | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| RPS6KA1 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPS6KA3 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPS6KA4 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPS6KA6 | Affinity Capture-MS, Co-fractionation, tandem affinity purification | association, physical | 22939629, 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPS6KB2 | Affinity Capture-MS | physical | 25324306, (Europe PMC) | NA | BioGRID |
| RYK | Affinity Capture-MS | physical | 21875946, (Europe PMC) | NA | BioGRID |
| SAFB | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SGK1 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| SKP1 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SLC25A5 | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| SLC25A6 | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| SMYD2 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| SMYD3 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SNRPE | Affinity Capture-Western | physical | 16322212, (Europe PMC) | NA | BioGRID |
| SNX5 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SPTBN4 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SQSTM1 | Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, tandem affinity purification, two hybrid, two hybrid array, two hybrid prey pooling approach | association, physical, physical association | 20562859, 21900206, 24189400, (Europe PMC) | 0.79 | BioGRID, IntAct, MINT |
| SRC | Reconstituted Complex | physical | 11085988, (Europe PMC) | NA | BioGRID |
| SSB | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| STAMBPL1 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| STIL | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STK11 | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping | association, physical, physical association | 14668798, 14676191, 20562859, 21860411, 25036637, (Europe PMC) | 0.69 | BioGRID, IntAct |
| STK32C | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| STK33 | Affinity Capture-MS, Affinity Capture-Western | physical | 22451720, (Europe PMC) | NA | BioGRID |
| STK35 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| STK36 | Affinity Capture-Western | physical | 17054904, (Europe PMC) | NA | BioGRID |
| STK38L | Affinity Capture-MS | physical | 24366813, (Europe PMC) | NA | BioGRID |
| STK4 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 24366813, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STUB1 | Affinity Capture-Luminescence, Affinity Capture-MS | physical | 25036637, (Europe PMC) | NA | BioGRID |
| SYNE2 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TARS2 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TBK1 | Affinity Capture-MS, tandem affinity purification | physical, physical association | 14743216, (Europe PMC) | 0.40 | BioGRID, IntAct |
| TERF1 | Affinity Capture-MS | physical | 20811636, (Europe PMC) | NA | BioGRID |
| TERF2 | Affinity Capture-MS | physical | 20811636, (Europe PMC) | NA | BioGRID |
| TNK2 | Affinity Capture-MS | physical | 28514442, 28739485, (Europe PMC) | NA | BioGRID |
| TOMM34 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TPM1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| TTC4 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TTC9C | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TUBA1B | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| TUBA1C | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| TUBB | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| U2AF2 | Affinity Capture-MS | physical | 26641092, (Europe PMC) | NA | BioGRID |
| UBE2I | Biochemical Activity | physical | 17709345, (Europe PMC) | NA | BioGRID |
| ULK1 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 20562859, (Europe PMC) | 0.40 | BioGRID, IntAct |
| ULK3 | Affinity Capture-MS, luminescence based mammalian interactome mapping | physical, physical association | 25036637, 26186194, (Europe PMC) | 0.40 | BioGRID, IntAct |
| UNC45A | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| UPF1 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| USP19 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| USP7 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| VCP | Affinity Capture-MS | physical | 23383273, (Europe PMC) | NA | BioGRID |
| WDR6 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YES1 | Affinity Capture-MS, luminescence based mammalian interactome mapping | physical, physical association | 25036637, 28514442, (Europe PMC) | 0.40 | BioGRID, IntAct |
| YWHAE | Affinity Capture-MS | physical | 20462248, (Europe PMC) | NA | BioGRID |
| YWHAQ | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ZNF205 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF235 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF266 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF667 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AHSA1 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AIP | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AKT1 | Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation | association, physical, physical association | 12176997, 22504172, 24869908, (Europe PMC) | 0.50 | BioGRID, IntAct |
| AKT2 | coimmunoprecipitation | physical association | 12176997, (Europe PMC) | 0.40 | IntAct |
| AKT3 | Affinity Capture-MS, coimmunoprecipitation, luminescence based mammalian interactome mapping | physical, physical association | 12176997, 25036637, 28514442, (Europe PMC) | 0.59 | BioGRID, IntAct |
| ALS2 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| AMHR2 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| APOE | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, two hybrid array | association, physical, physical association | 21163940, (Europe PMC) | 0.48 | BioGRID, IntAct |
| APP | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ARAF | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 24189400, 25036637, (Europe PMC) | 0.53 | BioGRID, IntAct |
| ATG12 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| AURKB | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping, proximity-dependent biotin identification, pull down | association, physical, physical association | 25036637, 26186194, 29568061, (Europe PMC) | 0.66 | BioGRID, IntAct |
| BRAF | Affinity Capture-MS, tandem affinity purification | association, physical | 17979178, 27034005, (Europe PMC) | 0.35 | BioGRID, IntAct |
| BTBD10 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| C12orf76 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| C19orf44 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CC2D1A | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CDC25C | Affinity Capture-MS, Affinity Capture-Western, pull down | association, physical | 17525741, 27432908, 28330616, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDC37L1 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDCA5 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDK1 | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 17525741, 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDK10 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| CDK11A | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 24189400, 25036637, 28514442, (Europe PMC) | 0.53 | BioGRID, IntAct |
| CDK11B | Affinity Capture-MS, Affinity Capture-Western, tandem affinity purification | association, physical | 15344906, 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDK13 | Affinity Capture-MS, luminescence based mammalian interactome mapping | physical, physical association | 25036637, 26186194, (Europe PMC) | 0.40 | BioGRID, IntAct |
| CDK15 | Affinity Capture-MS, luminescence based mammalian interactome mapping | physical, physical association | 25036637, 26186194, (Europe PMC) | 0.40 | BioGRID, IntAct |
| CDK4 | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, PCA, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, electron tomography, molecular sieving, tandem affinity purification, two hybrid | association, physical, physical association | 11867521, 17353931, 21675959, 21871133, 24189400, 25036637, 26186194, 27339980, 28514442, 8666233, 8703009, 9150368, (Europe PMC) | 0.89 | BioGRID, IntAct |
| CDK5 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CDK6 | Reconstituted Complex, coimmunoprecipitation, luminescence based mammalian interactome mapping, two hybrid | physical, physical association | 25036637, 8666233, 9150368, (Europe PMC) | 0.65 | BioGRID, IntAct |
| CDK7 | Affinity Capture-MS, Reconstituted Complex, proximity-dependent biotin identification, pull down | association, physical | 26186194, 29568061, 8666233, (Europe PMC) | 0.46 | BioGRID, IntAct |
| CDK8 | proximity-dependent biotin identification, pull down | association | 29568061, (Europe PMC) | 0.46 | IntAct |
| CDK9 | Affinity Capture-MS, luminescence based mammalian interactome mapping, tandem affinity purification | association, physical, physical association | 20305087, 23455922, 24189400, 25036637, 26186194, 28514442, (Europe PMC) | 0.67 | BioGRID, IntAct |
| CEP104 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CFLAR | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| CHGA | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CHORDC1 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CHUK | Affinity Capture-Luminescence, Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation, tandem affinity purification | association, physical, physical association | 11864612, 14743216, 21903422, 24189400, 25036637, (Europe PMC) | 0.74 | BioGRID, IntAct |
| CLK3 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CRYM | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CSNK2A2 | tandem affinity purification | association | 27705803, (Europe PMC) | 0.35 | IntAct |
| CTTN | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 24189400, 25036637, (Europe PMC) | 0.53 | BioGRID, IntAct |
| CUL3 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| CUL4A | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| CUL4B | luminescence based mammalian interactome mapping | physical association | 22939624, 25036637, (Europe PMC) | 0.59 | IntAct |
| CYP2C9 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| DAPK3 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| DCTN1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| DDR1 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DDR2 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| DDX17 | Affinity Capture-Luminescence, Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DDX5 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DEAF1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| DLD | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DMWD | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| DNAJB1 | Affinity Capture-Luminescence, Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, two hybrid array | association, physical, physical association | 21163940, 25036637, (Europe PMC) | 0.55 | BioGRID, IntAct |
| DNAJC7 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DNM1L | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DPCD | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| DPF1 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| DUS3L | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| EBI-8770671 | tandem affinity purification | association | 24189400, (Europe PMC) | 0.35 | IntAct |
| EBI-8770676 | tandem affinity purification | association | 24189400, (Europe PMC) | 0.35 | IntAct |
| ECSIT | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EGFR | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, luminescence based mammalian interactome mapping, tandem affinity purification | association, physical, physical association | 12471035, 23956138, 24189400, 25036637, (Europe PMC) | 0.62 | BioGRID, IntAct |
| EIF1B | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| EIF2AK1 | Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation | association, physical | 11036079, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EIF2AK2 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EIF2AK4 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| EIF3B | tandem affinity purification | association | 24189400, (Europe PMC) | 0.35 | IntAct |
| ELAVL3 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ELK3 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| ERBB2 | Affinity Capture-MS, luminescence based mammalian interactome mapping, tandem affinity purification | association, physical, physical association | 24189400, 25036637, (Europe PMC) | 0.56 | BioGRID, IntAct |
| ERBB3 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EVC2 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EXOSC1 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FBXL12 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FBXO38 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| FBXW2 | luminescence based mammalian interactome mapping | physical association | 22939624, 25036637, (Europe PMC) | 0.59 | IntAct |
| FBXW4 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FER | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping | association, physical, physical association | 25036637, (Europe PMC) | 0.50 | BioGRID, IntAct |
| FGFR3 | Affinity Capture-MS, Affinity Capture-Western, luminescence based mammalian interactome mapping | physical, physical association | 21487019, 25036637, (Europe PMC) | 0.40 | BioGRID, IntAct |
| FKBP4 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping | association, physical, physical association | 25036637, (Europe PMC) | 0.50 | BioGRID, IntAct |
| FKBP5 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FKBP6 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FKBPL | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FOXM1 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| FTSJ1 | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| FYN | Affinity Capture-MS, luminescence based mammalian interactome mapping | physical, physical association | 25036637, 28514442, (Europe PMC) | 0.40 | BioGRID, IntAct |
| GCDH | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GCH1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| GFAP | Affinity Capture-MS, two hybrid array, two hybrid prey pooling approach | physical, physical association | 24189400, (Europe PMC) | 0.49 | BioGRID, IntAct |
| GLMN | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GRK2 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| GSK3B | proximity-dependent biotin identification, pull down | association | 29568061, (Europe PMC) | 0.46 | IntAct |
| GTF2F1 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| GTF2IRD2 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| H2AFY2 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| HNRNPM | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HSP90AA1 | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, luminescence based mammalian interactome mapping, tandem affinity purification | association, physical, physical association | 11413142, 12176997, 12930845, 14718169, 15001580, 15647277, 19875381, 20159553, 21360678, 21871133, 22315411, 22504172, 22729780, 22939624, 24189400, 24462205, 25036637, 25486457, 26496610, 26804907, 27353360, 9685350, (Europe PMC) | 0.35, 0.89 | BioGRID, IntAct |
| HSP90AB1 | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, electron tomography, luminescence based mammalian interactome mapping, molecular sieving, tandem affinity purification | association, physical, physical association | 11036079, 22939624, 23428871, 24189400, 25036637, 25486457, 26496610, 27339980, 28215707, (Europe PMC) | 0.89 | BioGRID, IntAct |
| HSPA5 | tandem affinity purification | association | 24189400, (Europe PMC) | 0.35 | IntAct |
| IFIT3 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, pull down, two hybrid array | association, direct interaction, physical, physical association | 21163940, (Europe PMC) | 0.58 | BioGRID, IntAct |
| IFIT5 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| IKBKB | Affinity Capture-Luminescence, Affinity Capture-MS, Co-purification, Reconstituted Complex, anti tag coimmunoprecipitation, tandem affinity purification | association, physical, physical association | 11864612, 14743216, 21903422, 25036637, 26496610, (Europe PMC) | 0.74 | BioGRID, IntAct |
| IKBKE | Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping, tandem affinity purification | association, physical, physical association | 14743216, 17353931, 21903422, 25036637, (Europe PMC) | 0.77 | BioGRID, IntAct |
| IKBKG | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification | association, physical, physical association | 11864612, 14743216, 24189400, 24618592, 25036637, 26496610, (Europe PMC) | 0.80 | BioGRID, IntAct |
| IMMT | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| IRAK2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| KERA | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| KLHDC10 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| KLHL31 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| KSR2 | anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping | association, physical association | 25036637, 27086506, (Europe PMC) | 0.56 | IntAct |
| L3MBTL1 | tandem affinity purification | association | 27705803, (Europe PMC) | 0.35 | IntAct |
| LIMK2 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| LMX1B | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| LONP1 | two hybrid array | physical association | 21163940, (Europe PMC) | 0.37 | IntAct |
| LOXL4 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| LRRK2 | Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology, anti tag coimmunoprecipitation, tandem affinity purification | association, physical, physical association | 16321986, 18367605, 20642453, 22612223, 23075850, 26355680, (Europe PMC) | 0.85 | BioGRID, IntAct |
| LUC7L2 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| MAK | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| MAP3K1 | Affinity Capture-MS, tandem affinity purification | physical, physical association | 14743216, (Europe PMC) | 0.40 | BioGRID, IntAct |
| MAP3K14 | luminescence based mammalian interactome mapping, tandem affinity purification | physical association | 14743216, 25036637, (Europe PMC) | 0.59 | IntAct |
| MAP3K15 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| MAP3K3 | Affinity Capture-MS, tandem affinity purification | physical, physical association | 14743216, (Europe PMC) | 0.40 | BioGRID, IntAct |
| MAP3K7 | Affinity Capture-Western, anti bait coimmunoprecipitation, pull down, tandem affinity purification | association, physical, physical association | 14743216, 19026643, (Europe PMC) | 0.62 | BioGRID, IntAct, MINT |
| MAPK7 | Affinity Capture-Western, luminescence based mammalian interactome mapping | physical, physical association | 23428871, 25036637, (Europe PMC) | 0.40 | BioGRID, IntAct |
| MASP1 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MATK | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| MEF2B | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| MGEA5 | two hybrid array | physical association | 21163940, (Europe PMC) | 0.37 | IntAct |
| MOK | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| MOS | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| MRPL28 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| MTOR | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| MUSK | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| MYLK4 | Affinity Capture-MS, luminescence based mammalian interactome mapping | physical, physical association | 25036637, 26186194, (Europe PMC) | 0.40 | BioGRID, IntAct |
| MZT2B | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| NCOA5 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| NEK6 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| NEK8 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NFRKB | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| NLRP12 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| NOC4L | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| NOD1 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| NOS3 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, pull down, two hybrid array | association, direct interaction, physical, physical association | 21163940, (Europe PMC) | 0.58 | BioGRID, IntAct |
| NPR2 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| NR1I3 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| NUAK2 | tandem affinity purification | association | 16306228, (Europe PMC) | 0.35 | IntAct |
| NUP98 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| OFD1 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PANX1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PDIK1L | Affinity Capture-MS, luminescence based mammalian interactome mapping | physical, physical association | 25036637, 28514442, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PDPK1 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| PINK1 | Affinity Capture-MS, Affinity Capture-Western, luminescence based mammalian interactome mapping | physical, physical association | 18003639, 18359116, 21151955, 25036637, 28438176, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PITX2 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| POC1B | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| POLR1E | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| PPHLN1 | two hybrid | physical association | 21900206, (Europe PMC) | 0.37 | IntAct, MINT |
| PPID | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PPM1M | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| PPP2R1A | proximity-dependent biotin identification, pull down | association | 28330616, (Europe PMC) | 0.46 | IntAct |
| PPP5C | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, pull down | association, physical, physical association | 21360678, 25036637, 28330616, (Europe PMC) | 0.71 | BioGRID, IntAct |
| PRAM1 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PRDM1 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| PRDX2 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PRKAA1 | Affinity Capture-MS, luminescence based mammalian interactome mapping, tandem affinity purification | association, physical, physical association | 16306228, 25036637, (Europe PMC) | 0.35, 0.40 | BioGRID, IntAct |
| PRKAB1 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| PRKCI | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 14676191, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PRMT1 | two hybrid, two hybrid array, two hybrid prey pooling approach | physical association | 21900206, (Europe PMC) | 0.37, 0.49 | IntAct, MINT |
| PRPF4 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSEN1 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, two hybrid array | association, physical, physical association | 21163940, (Europe PMC) | 0.48 | BioGRID, IntAct |
| PSKH2 | Affinity Capture-MS, luminescence based mammalian interactome mapping | physical, physical association | 25036637, 26186194, 28514442, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PSME1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| RAD23A | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RAE1 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RAF1 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping, tandem affinity purification | association, physical, physical association | 17979178, 24189400, 25036637, (Europe PMC) | 0.71 | BioGRID, IntAct |
| RASSF3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 24366813, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RGS11 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| RIPK1 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| RIPK3 | Affinity Capture-MS, tandem affinity purification | physical, physical association | 14743216, 21903422, (Europe PMC) | 0.40 | BioGRID, IntAct |
| RIPK4 | anti tag coimmunoprecipitation | association | 26972000, (Europe PMC) | 0.35 | IntAct |
| RNF32 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RPAP3 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPS15A | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| RPS2 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPS6KA1 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPS6KA3 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPS6KA4 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPS6KA6 | Affinity Capture-MS, Co-fractionation, tandem affinity purification | association, physical | 22939629, 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SAFB | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SGK1 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| SKP1 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SLITRK6 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| SMYD2 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| SMYD3 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SNX5 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SPTBN4 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SQSTM1 | Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, tandem affinity purification, two hybrid, two hybrid array, two hybrid prey pooling approach | association, physical, physical association | 20562859, 21900206, 24189400, (Europe PMC) | 0.79 | BioGRID, IntAct, MINT |
| STAMBPL1 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| STIL | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STK11 | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping | association, physical, physical association | 14668798, 14676191, 20562859, 21860411, 25036637, (Europe PMC) | 0.69 | BioGRID, IntAct |
| STK38L | anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping | association, physical association | 24366813, 25036637, (Europe PMC) | 0.56 | IntAct |
| STK4 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 24366813, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STUB1 | anti tag coimmunoprecipitation | association | 25036637, (Europe PMC) | 0.35 | IntAct |
| SYNE2 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TARS2 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TBK1 | Affinity Capture-MS, tandem affinity purification | physical, physical association | 14743216, (Europe PMC) | 0.40 | BioGRID, IntAct |
| TESK2 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| TIE1 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| TNFRSF14 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| TNK1 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| TOMM34 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TRAF6 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| TSSK6 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| TTC4 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TTC9C | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TUBB1 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| TUT1 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| ULK1 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 20562859, (Europe PMC) | 0.40 | BioGRID, IntAct |
| ULK2 | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| ULK3 | Affinity Capture-MS, luminescence based mammalian interactome mapping | physical, physical association | 25036637, 26186194, (Europe PMC) | 0.40 | BioGRID, IntAct |
| UNC45A | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| UPF1 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| URI1 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| USP19 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| USP49 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| VSX2 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| WDR13 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| WDR6 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| WDR61 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| WDR70 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| YES1 | Affinity Capture-MS, luminescence based mammalian interactome mapping | physical, physical association | 25036637, 28514442, (Europe PMC) | 0.40 | BioGRID, IntAct |
| YWHAQ | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ZBTB20 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| ZBTB40 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| ZGPAT | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| ZNF205 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF235 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF266 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF334 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| ZNF569 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| ZNF587 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| ZNF610 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| ZNF667 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF843 | luminescence based mammalian interactome mapping | physical association | 22939624, 25036637, (Europe PMC) | 0.59 | IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| C19orf44 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CC2D1A | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CHGA | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CRYM | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| DCTN1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| DEAF1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| GCH1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| IMMT | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| LUC7L2 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| MAP3K7 | Affinity Capture-Western, anti bait coimmunoprecipitation, pull down, tandem affinity purification | association, physical, physical association | 14743216, 19026643, (Europe PMC) | 0.62 | BioGRID, IntAct, MINT |
| MTOR | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| MZT2B | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| NCOA5 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PPHLN1 | two hybrid | physical association | 21900206, (Europe PMC) | 0.37 | IntAct, MINT |
| PRMT1 | two hybrid, two hybrid array, two hybrid prey pooling approach | physical association | 21900206, (Europe PMC) | 0.37, 0.49 | IntAct, MINT |
| PSME1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| RPS15A | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SAFB | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SNX5 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SPTBN4 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SQSTM1 | Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, tandem affinity purification, two hybrid, two hybrid array, two hybrid prey pooling approach | association, physical, physical association | 20562859, 21900206, 24189400, (Europe PMC) | 0.79 | BioGRID, IntAct, MINT |
| ZNF205 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF235 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF266 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF667 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ABL2 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AHCYL1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| AHSA1 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AIP | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AKT1 | Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation | association, physical, physical association | 12176997, 22504172, 24869908, (Europe PMC) | 0.50 | BioGRID, IntAct |
| AKT2 | coimmunoprecipitation | physical association | 12176997, (Europe PMC) | 0.40 | IntAct |
| AKT3 | Affinity Capture-MS, coimmunoprecipitation, luminescence based mammalian interactome mapping | physical, physical association | 12176997, 25036637, 28514442, (Europe PMC) | 0.59 | BioGRID, IntAct |
| ALS2 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| AMHR2 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| APOE | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, two hybrid array | association, physical, physical association | 21163940, (Europe PMC) | 0.48 | BioGRID, IntAct |
| APP | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| AR | Reconstituted Complex | physical | 11085988, (Europe PMC) | NA | BioGRID |
| ARAF | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 24189400, 25036637, (Europe PMC) | 0.53 | BioGRID, IntAct |
| ATG101 | Affinity Capture-MS | physical | 20562859, (Europe PMC) | NA | BioGRID |
| ATG12 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| AURKA | Affinity Capture-MS | physical | 23443559, (Europe PMC) | NA | BioGRID |
| AURKB | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping, proximity-dependent biotin identification, pull down | association, physical, physical association | 25036637, 26186194, 29568061, (Europe PMC) | 0.66 | BioGRID, IntAct |
| AURKC | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| BRAF | Affinity Capture-MS, tandem affinity purification | association, physical | 17979178, 27034005, (Europe PMC) | 0.35 | BioGRID, IntAct |
| BRCA1 | Affinity Capture-MS | physical | 26831064, (Europe PMC) | NA | BioGRID |
| BTBD10 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| BTK | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| C12orf76 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| C19orf44 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CC2D1A | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CDC25C | Affinity Capture-MS, Affinity Capture-Western, pull down | association, physical | 17525741, 27432908, 28330616, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDC37 | Affinity Capture-MS, Co-fractionation, PCA, Reconstituted Complex | physical | 11916974, 21675959, 24189400, (Europe PMC) | NA | BioGRID |
| CDC37L1 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDCA5 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDK1 | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 17525741, 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDK10 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| CDK11A | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 24189400, 25036637, 28514442, (Europe PMC) | 0.53 | BioGRID, IntAct |
| CDK11B | Affinity Capture-MS, Affinity Capture-Western, tandem affinity purification | association, physical | 15344906, 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDK13 | Affinity Capture-MS, luminescence based mammalian interactome mapping | physical, physical association | 25036637, 26186194, (Europe PMC) | 0.40 | BioGRID, IntAct |
| CDK15 | Affinity Capture-MS, luminescence based mammalian interactome mapping | physical, physical association | 25036637, 26186194, (Europe PMC) | 0.40 | BioGRID, IntAct |
| CDK18 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| CDK4 | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, PCA, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, electron tomography, molecular sieving, tandem affinity purification, two hybrid | association, physical, physical association | 11867521, 17353931, 21675959, 21871133, 24189400, 25036637, 26186194, 27339980, 28514442, 8666233, 8703009, 9150368, (Europe PMC) | 0.89 | BioGRID, IntAct |
| CDK5 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CDK6 | Reconstituted Complex, coimmunoprecipitation, luminescence based mammalian interactome mapping, two hybrid | physical, physical association | 25036637, 8666233, 9150368, (Europe PMC) | 0.65 | BioGRID, IntAct |
| CDK7 | Affinity Capture-MS, Reconstituted Complex, proximity-dependent biotin identification, pull down | association, physical | 26186194, 29568061, 8666233, (Europe PMC) | 0.46 | BioGRID, IntAct |
| CDK8 | proximity-dependent biotin identification, pull down | association | 29568061, (Europe PMC) | 0.46 | IntAct |
| CDK9 | Affinity Capture-MS, luminescence based mammalian interactome mapping, tandem affinity purification | association, physical, physical association | 20305087, 23455922, 24189400, 25036637, 26186194, 28514442, (Europe PMC) | 0.67 | BioGRID, IntAct |
| CDKL1 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| CDKL2 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| CEP104 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CFLAR | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| CFTR | Affinity Capture-MS | physical | 26618866, (Europe PMC) | NA | BioGRID |
| CHGA | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CHORDC1 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CHUK | Affinity Capture-Luminescence, Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation, tandem affinity purification | association, physical, physical association | 11864612, 14743216, 21903422, 24189400, 25036637, (Europe PMC) | 0.74 | BioGRID, IntAct |
| CKS1B | Reconstituted Complex | physical | 19786724, (Europe PMC) | NA | BioGRID |
| CKS2 | Reconstituted Complex | physical | 19786724, (Europe PMC) | NA | BioGRID |
| CLK3 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CPLANE2 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| CRYM | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CSNK2A2 | tandem affinity purification | association | 27705803, (Europe PMC) | 0.35 | IntAct |
| CTTN | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 24189400, 25036637, (Europe PMC) | 0.53 | BioGRID, IntAct |
| CUL3 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| CUL4A | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| CUL4B | luminescence based mammalian interactome mapping | physical association | 22939624, 25036637, (Europe PMC) | 0.59 | IntAct |
| CYLD | Affinity Capture-MS | physical | 27591049, (Europe PMC) | NA | BioGRID |
| CYP2C9 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| DAPK3 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| DCTN1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| DDR1 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DDR2 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| DDX17 | Affinity Capture-Luminescence, Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DDX5 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DEAF1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| DLD | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DMWD | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| DNAJB1 | Affinity Capture-Luminescence, Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, two hybrid array | association, physical, physical association | 21163940, 25036637, (Europe PMC) | 0.55 | BioGRID, IntAct |
| DNAJC7 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DNM1L | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DPCD | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| DPF1 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| DUS3L | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| EBI-8770671 | tandem affinity purification | association | 24189400, (Europe PMC) | 0.35 | IntAct |
| EBI-8770676 | tandem affinity purification | association | 24189400, (Europe PMC) | 0.35 | IntAct |
| ECSIT | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EDEM3 | Affinity Capture-MS | physical | 28366632, (Europe PMC) | NA | BioGRID |
| EEF1A1 | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| EEF1A1P5 | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| EEF1A2 | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| EGFR | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, luminescence based mammalian interactome mapping, tandem affinity purification | association, physical, physical association | 12471035, 23956138, 24189400, 25036637, (Europe PMC) | 0.62 | BioGRID, IntAct |
| EIF1B | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| EIF2AK1 | Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation | association, physical | 11036079, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EIF2AK2 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EIF2AK4 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| EIF2S1 | Reconstituted Complex | physical | 12930845, (Europe PMC) | NA | BioGRID |
| EIF3B | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| EIF3B | tandem affinity purification | association | 24189400, (Europe PMC) | 0.35 | IntAct |
| ELAVL3 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ELK3 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| EMD | Affinity Capture-MS | physical | 17620012, (Europe PMC) | NA | BioGRID |
| ERBB2 | Affinity Capture-MS, luminescence based mammalian interactome mapping, tandem affinity purification | association, physical, physical association | 24189400, 25036637, (Europe PMC) | 0.56 | BioGRID, IntAct |
| ERBB3 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ESRRB | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| EVC2 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EWSR1 | Proximity Label-MS | physical | 24999758, (Europe PMC) | NA | BioGRID |
| EXOSC1 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FBXL12 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FBXO38 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| FBXO6 | Affinity Capture-MS | physical | 22268729, (Europe PMC) | NA | BioGRID |
| FBXW2 | luminescence based mammalian interactome mapping | physical association | 22939624, 25036637, (Europe PMC) | 0.59 | IntAct |
| FBXW4 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FER | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping | association, physical, physical association | 25036637, (Europe PMC) | 0.50 | BioGRID, IntAct |
| FGFR3 | Affinity Capture-MS, Affinity Capture-Western, luminescence based mammalian interactome mapping | physical, physical association | 21487019, 25036637, (Europe PMC) | 0.40 | BioGRID, IntAct |
| FKBP4 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping | association, physical, physical association | 25036637, (Europe PMC) | 0.50 | BioGRID, IntAct |
| FKBP5 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FKBP6 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FKBPL | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FLCN | Affinity Capture-Western | physical | 27353360, (Europe PMC) | NA | BioGRID |
| FNIP1 | Affinity Capture-Western | physical | 27353360, (Europe PMC) | NA | BioGRID |
| FNIP2 | Affinity Capture-Western | physical | 27353360, (Europe PMC) | NA | BioGRID |
| FOXM1 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| FTSJ1 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| FTSJ1 | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| FYN | Affinity Capture-MS, luminescence based mammalian interactome mapping | physical, physical association | 25036637, 28514442, (Europe PMC) | 0.40 | BioGRID, IntAct |
| GCDH | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GCH1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| GFAP | Affinity Capture-MS, two hybrid array, two hybrid prey pooling approach | physical, physical association | 24189400, (Europe PMC) | 0.49 | BioGRID, IntAct |
| GLMN | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GRK2 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| GRK5 | Affinity Capture-MS | physical | 22952844, (Europe PMC) | NA | BioGRID |
| GSK3B | proximity-dependent biotin identification, pull down | association | 29568061, (Europe PMC) | 0.46 | IntAct |
| GTF2F1 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| GTF2IRD2 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| H2AFY2 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| HCK | Affinity Capture-Western | physical | 11413142, (Europe PMC) | NA | BioGRID |
| HNRNPM | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HSP90AA1 | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, luminescence based mammalian interactome mapping, tandem affinity purification | association, physical, physical association | 11413142, 12176997, 12930845, 14718169, 15001580, 15647277, 19875381, 20159553, 21360678, 21871133, 22315411, 22504172, 22729780, 22939624, 24189400, 24462205, 25036637, 25486457, 26496610, 26804907, 27353360, 9685350, (Europe PMC) | 0.35, 0.89 | BioGRID, IntAct |
| HSP90AB1 | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, electron tomography, luminescence based mammalian interactome mapping, molecular sieving, tandem affinity purification | association, physical, physical association | 11036079, 22939624, 23428871, 24189400, 25036637, 25486457, 26496610, 27339980, 28215707, (Europe PMC) | 0.89 | BioGRID, IntAct |
| HSPA1A | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| HSPA5 | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| HSPA5 | tandem affinity purification | association | 24189400, (Europe PMC) | 0.35 | IntAct |
| HSPA8 | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| IFIT3 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, pull down, two hybrid array | association, direct interaction, physical, physical association | 21163940, (Europe PMC) | 0.58 | BioGRID, IntAct |
| IFIT5 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| IKBKB | Affinity Capture-Luminescence, Affinity Capture-MS, Co-purification, Reconstituted Complex, anti tag coimmunoprecipitation, tandem affinity purification | association, physical, physical association | 11864612, 14743216, 21903422, 25036637, 26496610, (Europe PMC) | 0.74 | BioGRID, IntAct |
| IKBKE | Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping, tandem affinity purification | association, physical, physical association | 14743216, 17353931, 21903422, 25036637, (Europe PMC) | 0.77 | BioGRID, IntAct |
| IKBKG | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification | association, physical, physical association | 11864612, 14743216, 24189400, 24618592, 25036637, 26496610, (Europe PMC) | 0.80 | BioGRID, IntAct |
| IMMT | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| IRAK1 | Affinity Capture-Western, Co-fractionation | physical | 15647277, (Europe PMC) | NA | BioGRID |
| IRAK2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ITK | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| KEAP1 | Affinity Capture-MS | physical | 27621311, (Europe PMC) | NA | BioGRID |
| KERA | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| KLHDC10 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| KLHL31 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| KSR2 | anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping | association, physical association | 25036637, 27086506, (Europe PMC) | 0.56 | IntAct |
| L3MBTL1 | tandem affinity purification | association | 27705803, (Europe PMC) | 0.35 | IntAct |
| LIMK2 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| LMX1B | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| LONP1 | Two-hybrid | physical | 21163940, (Europe PMC) | NA | BioGRID |
| LONP1 | two hybrid array | physical association | 21163940, (Europe PMC) | 0.37 | IntAct |
| LOXL4 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| LRRK1 | Affinity Capture-MS | physical | 20697350, (Europe PMC) | NA | BioGRID |
| LRRK2 | Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology, anti tag coimmunoprecipitation, tandem affinity purification | association, physical, physical association | 16321986, 18367605, 20642453, 22612223, 23075850, 26355680, (Europe PMC) | 0.85 | BioGRID, IntAct |
| LUC7L2 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| MAK | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| MAP2K5 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| MAP3K1 | Affinity Capture-MS, tandem affinity purification | physical, physical association | 14743216, (Europe PMC) | 0.40 | BioGRID, IntAct |
| MAP3K11 | Affinity Capture-MS, Affinity Capture-Western | physical | 15001580, (Europe PMC) | NA | BioGRID |
| MAP3K14 | luminescence based mammalian interactome mapping, tandem affinity purification | physical association | 14743216, 25036637, (Europe PMC) | 0.59 | IntAct |
| MAP3K15 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| MAP3K3 | Affinity Capture-MS, tandem affinity purification | physical, physical association | 14743216, (Europe PMC) | 0.40 | BioGRID, IntAct |
| MAP3K6 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| MAP3K7 | Affinity Capture-Western, anti bait coimmunoprecipitation, pull down, tandem affinity purification | association, physical, physical association | 14743216, 19026643, (Europe PMC) | 0.62 | BioGRID, IntAct, MINT |
| MAPK7 | Affinity Capture-Western, luminescence based mammalian interactome mapping | physical, physical association | 23428871, 25036637, (Europe PMC) | 0.40 | BioGRID, IntAct |
| MASP1 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MATK | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| MEF2B | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| MGEA5 | two hybrid array | physical association | 21163940, (Europe PMC) | 0.37 | IntAct |
| MOK | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| MOS | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| MOV10 | Affinity Capture-RNA | physical | 22658674, (Europe PMC) | NA | BioGRID |
| MRPL28 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| MTOR | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| MUSK | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| MYLK4 | Affinity Capture-MS, luminescence based mammalian interactome mapping | physical, physical association | 25036637, 26186194, (Europe PMC) | 0.40 | BioGRID, IntAct |
| MZT2B | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| NCOA5 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| NEK6 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| NEK8 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NFRKB | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| NLRP12 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| NOC4L | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| NOD1 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| NOS3 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, pull down, two hybrid array | association, direct interaction, physical, physical association | 21163940, (Europe PMC) | 0.58 | BioGRID, IntAct |
| NPM1 | Affinity Capture-MS | physical | 23402259, (Europe PMC) | NA | BioGRID |
| NPR2 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| NR1I3 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| NTRK1 | Affinity Capture-MS, Affinity Capture-Western | physical | 20663926, 25921289, (Europe PMC) | NA | BioGRID |
| NUAK2 | tandem affinity purification | association | 16306228, (Europe PMC) | 0.35 | IntAct |
| NUP98 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NXF1 | Affinity Capture-RNA | physical | 22658674, (Europe PMC) | NA | BioGRID |
| OFD1 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| OGA | Co-fractionation, Two-hybrid | physical | 21163940, 22863883, 26344197, (Europe PMC) | NA | BioGRID |
| OGFR | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| PANX1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PATL1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PCBP1 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| PDIK1L | Affinity Capture-MS, luminescence based mammalian interactome mapping | physical, physical association | 25036637, 28514442, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PDPK1 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| PDZK1 | Affinity Capture-Western | physical | 24869908, (Europe PMC) | NA | BioGRID |
| PINK1 | Affinity Capture-MS, Affinity Capture-Western, luminescence based mammalian interactome mapping | physical, physical association | 18003639, 18359116, 21151955, 25036637, 28438176, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PITX2 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| PKM | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| POC1B | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| POLR1E | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| PPHLN1 | Two-hybrid | physical | 21900206, (Europe PMC) | NA | BioGRID |
| PPHLN1 | two hybrid | physical association | 21900206, (Europe PMC) | 0.37 | IntAct, MINT |
| PPID | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PPM1M | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| PPP2R1A | proximity-dependent biotin identification, pull down | association | 28330616, (Europe PMC) | 0.46 | IntAct |
| PPP5C | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, pull down | association, physical, physical association | 21360678, 25036637, 28330616, (Europe PMC) | 0.71 | BioGRID, IntAct |
| PPP6R3 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| PRAM1 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PRDM1 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| PRDX2 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PRKAA1 | Affinity Capture-MS, luminescence based mammalian interactome mapping, tandem affinity purification | association, physical, physical association | 16306228, 25036637, (Europe PMC) | 0.35, 0.40 | BioGRID, IntAct |
| PRKAB1 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| PRKCI | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 14676191, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PRMT1 | Two-hybrid | physical | 21900206, (Europe PMC) | NA | BioGRID |
| PRMT1 | two hybrid, two hybrid array, two hybrid prey pooling approach | physical association | 21900206, (Europe PMC) | 0.37, 0.49 | IntAct, MINT |
| PRPF4 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSEN1 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, two hybrid array | association, physical, physical association | 21163940, (Europe PMC) | 0.48 | BioGRID, IntAct |
| PSKH2 | Affinity Capture-MS, luminescence based mammalian interactome mapping | physical, physical association | 25036637, 26186194, 28514442, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PSME1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PTGES3 | Reconstituted Complex | physical | 22504172, (Europe PMC) | NA | BioGRID |
| RAD23A | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RAE1 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RAF1 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping, tandem affinity purification | association, physical, physical association | 17979178, 24189400, 25036637, (Europe PMC) | 0.71 | BioGRID, IntAct |
| RASSF3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 24366813, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RGS11 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| RHOBTB2 | Affinity Capture-MS | physical | 24608665, (Europe PMC) | NA | BioGRID |
| RIPK1 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| RIPK3 | Affinity Capture-MS, tandem affinity purification | physical, physical association | 14743216, 21903422, (Europe PMC) | 0.40 | BioGRID, IntAct |
| RIPK4 | anti tag coimmunoprecipitation | association | 26972000, (Europe PMC) | 0.35 | IntAct |
| RNF32 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RPAP3 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPS15A | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| RPS2 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPS27 | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| RPS27L | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| RPS6KA1 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPS6KA3 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPS6KA4 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPS6KA6 | Affinity Capture-MS, Co-fractionation, tandem affinity purification | association, physical | 22939629, 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPS6KB2 | Affinity Capture-MS | physical | 25324306, (Europe PMC) | NA | BioGRID |
| RYK | Affinity Capture-MS | physical | 21875946, (Europe PMC) | NA | BioGRID |
| SAFB | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SGK1 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| SKP1 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SLC25A5 | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| SLC25A6 | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| SLITRK6 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| SMYD2 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| SMYD3 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SNRPE | Affinity Capture-Western | physical | 16322212, (Europe PMC) | NA | BioGRID |
| SNX5 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SPTBN4 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SQSTM1 | Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, tandem affinity purification, two hybrid, two hybrid array, two hybrid prey pooling approach | association, physical, physical association | 20562859, 21900206, 24189400, (Europe PMC) | 0.79 | BioGRID, IntAct, MINT |
| SRC | Reconstituted Complex | physical | 11085988, (Europe PMC) | NA | BioGRID |
| SSB | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| STAMBPL1 | Two-hybrid, two hybrid array | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| STIL | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STK11 | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping | association, physical, physical association | 14668798, 14676191, 20562859, 21860411, 25036637, (Europe PMC) | 0.69 | BioGRID, IntAct |
| STK32C | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| STK33 | Affinity Capture-MS, Affinity Capture-Western | physical | 22451720, (Europe PMC) | NA | BioGRID |
| STK35 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| STK36 | Affinity Capture-Western | physical | 17054904, (Europe PMC) | NA | BioGRID |
| STK38L | Affinity Capture-MS | physical | 24366813, (Europe PMC) | NA | BioGRID |
| STK38L | anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping | association, physical association | 24366813, 25036637, (Europe PMC) | 0.56 | IntAct |
| STK4 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 24366813, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STUB1 | Affinity Capture-Luminescence, Affinity Capture-MS | physical | 25036637, (Europe PMC) | NA | BioGRID |
| STUB1 | anti tag coimmunoprecipitation | association | 25036637, (Europe PMC) | 0.35 | IntAct |
| SYNE2 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TARS2 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TBK1 | Affinity Capture-MS, tandem affinity purification | physical, physical association | 14743216, (Europe PMC) | 0.40 | BioGRID, IntAct |
| TERF1 | Affinity Capture-MS | physical | 20811636, (Europe PMC) | NA | BioGRID |
| TERF2 | Affinity Capture-MS | physical | 20811636, (Europe PMC) | NA | BioGRID |
| TESK2 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| TIE1 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| TNFRSF14 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| TNK1 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| TNK2 | Affinity Capture-MS | physical | 28514442, 28739485, (Europe PMC) | NA | BioGRID |
| TOMM34 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TPM1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| TRAF6 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| TSSK6 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| TTC4 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TTC9C | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TUBA1B | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| TUBA1C | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| TUBB | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| TUBB1 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| TUT1 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| U2AF2 | Affinity Capture-MS | physical | 26641092, (Europe PMC) | NA | BioGRID |
| UBE2I | Biochemical Activity | physical | 17709345, (Europe PMC) | NA | BioGRID |
| ULK1 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 20562859, (Europe PMC) | 0.40 | BioGRID, IntAct |
| ULK2 | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| ULK3 | Affinity Capture-MS, luminescence based mammalian interactome mapping | physical, physical association | 25036637, 26186194, (Europe PMC) | 0.40 | BioGRID, IntAct |
| UNC45A | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| UPF1 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| URI1 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| USP19 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| USP49 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| USP7 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| VCP | Affinity Capture-MS | physical | 23383273, (Europe PMC) | NA | BioGRID |
| VSX2 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| WDR13 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| WDR6 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| WDR61 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| WDR70 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| YES1 | Affinity Capture-MS, luminescence based mammalian interactome mapping | physical, physical association | 25036637, 28514442, (Europe PMC) | 0.40 | BioGRID, IntAct |
| YWHAE | Affinity Capture-MS | physical | 20462248, (Europe PMC) | NA | BioGRID |
| YWHAQ | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ZBTB20 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| ZBTB40 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| ZGPAT | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| ZNF205 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF235 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF266 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF334 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| ZNF569 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| ZNF587 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| ZNF610 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| ZNF667 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF843 | luminescence based mammalian interactome mapping | physical association | 22939624, 25036637, (Europe PMC) | 0.59 | IntAct |
| Phosphorylating Kinases | Phosphoresidues | Detection Method | PubMed IDs | Source |
| CK2_alpha | S13_VWDHIEVsDDEDETH, | LTP | 12930845, 15082798,(Europe PMC) | PhosphoELM, |
| CK2_group | S13_VWDHIEVsDDEDETH, | LTP | 12930845, 15082798,(Europe PMC) | PhosphoELM, |
| CSNK2A1 | S13_VWDHIEVsDDEDETH, | in vivo | 12930845, 15082798, 19413330, 20068231,(Europe PMC) | HPRD, PhosphoSitePlus, |
| CSNK2A2 | S13_VWDHIEVsDDEDETH, | in vivo | 12930845, 15082798, 19413330, 20068231,(Europe PMC) | HPRD, PhosphoSitePlus, |
| ULK1 | S339_HMQRCIDsGLWVPNS, | NA | NA | PhosphoSitePlus, |
| Unknown | S13_VWDHIEVsDDEDETH, S377_TGDEKDVsV, Y298_GLDPVEVyESLPEEL, | HTP, in vivo | 12930845, 15082798, 15592455, 18669648, 19413330, 20068231,(Europe PMC) | HPRD, PhosphoELM, |
| YES1 | Y298_GLDPVEVyESLPEEL, | NA | NA | PhosphoSitePlus, |