- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
CDC25C
Gene Name  | CDC25C (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: 5M37 |
| Synonyms | CDC25C | |
| Protein Name | CDC25C | |
| Alternative Name(s) | M-phase inducer phosphatase 3;3.1.3.48;Dual specificity phosphatase Cdc25C; | |
| Protein Family | Belongs to the MPI phosphatase family | |
| EntrezGene ID | 995 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P30307 (protein sequence) | |
| Enzyme Class | 3.1.3.48 (BRENDA ) | |
| Molecular Weight | 53365 Dalton | |
| Protein Length | 473 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000158402 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - KOG3772 | eggNOG - COG5105 | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Nucleus | |||
| Function (UniProt annotation) | |||
| Functions as a dosage-dependent inducer in mitoticcontrol Tyrosine protein phosphatase required for progression ofthe cell cycle When phosphorylated, highly effective inactivating G2 cells into prophase Directly dephosphorylates CDK1and activates its kinase activity | |||
| Catalytic Activity (UniProt annotation) | |||
| Protein tyrosine phosphate + H(2)O = proteintyrosine + phosphate | |||
| Protein Sequence | |||
| MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSG EITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVD SEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDK VKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQG LIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQ YPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| DEG_APCC_KENBOX_2 | 150-NKEND-154 | APCC-binding Destruction motifs | .KEN. | MOD_Plk_1 | 195-MEFSLKD-201 | Polo-like kinase phosphosites | .[DNE][^PG][ST](([FYILMVW]..)|([^PEDGKN][FWYLIVM]).) | MOD_Plk_2-3 | 188-EEISDEL-194 | Polo-like kinase phosphosites | [DE]..([ST])[EDILMVFWY](([DE].)|(.[DE])) | TRG_NES_CRM1_1 | 189-EISDELMEFSLKDQE-203 | NES Nuclear Export Signal | ([DEQ].{0,1}[LIM].{2,3}[LIVMF][^P]{2,3}[LMVF].[LMIV].{0,3}[DE])|([DE].{0,1}[LIM].{2,3}[LIVMF][^P]{2,3}[LMVF].[LMIV].{0,3}[DEQ]) |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000079 | P:regulation of cyclin-dependent protein serine/threonine kinase activity |
| GO:0000086 | P:G2/M transition of mitotic cell cycle |
| GO:0004721 | F:phosphoprotein phosphatase activity |
| GO:0004725 | F:protein tyrosine phosphatase activity |
| GO:0005634 | C:nucleus |
| GO:0005654 | C:nucleoplasm |
| GO:0005829 | C:cytosol |
| GO:0006977 | P:DNA damage response |
| GO:0007088 | signal transduction by p53 class mediator resulting in cell cycle arrest |
| GO:0007283 | P:regulation of mitotic nuclear division |
| GO:0008283 | P:spermatogenesis |
| GO:0016032 | P:cell proliferation |
| GO:0016607 | P:viral process |
| GO:0019901 | C:nuclear speck |
| GO:0048471 | F:protein kinase binding |
| GO:0050699 | C:perinuclear region of cytoplasm |
| GO:0051301 | F:WW domain binding |
| GO:1902751 | P:cell division |
CDC25C is dephosphorylated by following phosphatases:
| Phosphatase Gene Name | Phosphatase UniProt_AC | DephosphoSite and sequence (+/-5) in CDC25C (P30307) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| CDC14B | O60729 | NA | In vitro and in vivo | 21379580, | Europe PMC |  |
| PPP1CA | P62136 | Ser-216_LYRSPsMPENL, | In vitro | 14592972, 16467385, | Europe PMC | |
| PPP1CB | P62140 | Ser-216_LYRSPsMPENL, | In vitro | 14592972, 16467385, | Europe PMC | |
| PPP1CC | P36873 | Ser-216_LYRSPsMPENL, | In vitro | 14592972, 16467385, | Europe PMC | |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| hsa04110 | Cell cycle | Mitotic cell cycle progression is accomplished through a reproducible sequence of events, DNA replication (S phase) and mitosis (M phase) separated temporally by gaps known as G1 and G2 phases. Cyclin-dependent kinases (CDKs) are key regulatory enzymes, each consisting of a catalytic CDK subunit and an activating cyclin subunit. CDKs regulate the cell's progression through the phases of the cell cycle by modulating the activity of key substrates. Downstream targets of CDKs include transcription factor E2F and its regulator Rb. Precise activation and inactivation of CDKs at specific points in the cell cycle are required for orderly cell division. Cyclin-CDK inhibitors (CKIs), such as p16Ink4a, p15Ink4b, p27Kip1, and p21Cip1, are involved in the negative regulation of CDK activities, thus providing a pathway through which the cell cycle is negatively regulated.Eukaryotic cells respond to DNA damage by activating signaling pathways that promote cell cycle arrest and DNA repair. In response to DNA damage, the checkpoint kinase ATM phosphorylates and activates Chk2, which in turn directly phosphorylates and activates p53 tumor suppressor protein. p53 and its transcriptional targets play an important role in both G1 and G2 checkpoints. ATR-Chk1-mediated protein degradation of Cdc25A protein phosphatase is also a mechanism conferring intra-S-phase checkpoint activation. |
| hsa04114 | Oocyte meiosis | During meiosis, a single round of DNA replication is followed by two rounds of chromosome segregation, called meiosis I and meiosis II. At meiosis I, homologous chromosomes recombine and then segregate to opposite poles, while the sister chromatids segregate from each other at meoisis II. In vertebrates, immature oocytes are arrested at the PI (prophase of meiosis I). The resumption of meiosis is stimulated by progesterone, which carries the oocyte through two consecutive M-phases (MI and MII) to a second arrest at MII. The key activity driving meiotic progression is the MPF (maturation-promoting factor), a heterodimer of CDC2 (cell division cycle 2 kinase) and cyclin B. In PI-arrested oocytes, MPF is initially inactive and is activated by the dual-specificity CDC25C phosphatase as the result of new synthesis of Mos induced by progesterone. MPF activation mediates the transition from the PI arrest to MI. The subsequent decrease in MPF levels, required to exit from MI into interkinesis, is induced by a negative feedback loop, where CDC2 brings about the activation of the APC (anaphase-promoting complex), which mediates destruction of cyclin B. Re-activation of MPF for MII requires re-accumulation of high levels of cyclin B as well as the inactivation of the APC by newly synthesized Emi2 and other components of the CSF (cytostatic factor), such as cyclin E or high levels of Mos. CSF antagonizes the ubiquitin ligase activity of the APC, preventing cyclin B destruction and meiotic exit until fertilization occurs. Fertilization triggers a transient increase in cytosolic free Ca2+, which leads to CSF inactivation and cyclin B destruction through the APC. Then eggs are released from MII into the first embryonic cell cycle. |
| hsa04914 | Progesterone-mediated oocyte maturation | Xenopus oocytes are naturally arrested at G2 of meiosis I. Exposure to either insulin/IGF-1 or the steroid hormone progesterone breaks this arrest and induces resumption of the two meiotic division cycles and maturation of the oocyte into a mature, fertilizable egg. This process is termed oocyte maturation. The transition is accompanied by an increase in maturation promoting factor (MPF or Cdc2/cyclin B) which precedes germinal vesicle breakdown (GVBD). Most reports point towards the Mos-MEK1-ERK2 pathway [where ERK is an extracellular signal-related protein kinase, MEK is a MAPK/ERK kinase and Mos is a p42(MAPK) activator] and the polo-like kinase/CDC25 pathway as responsible for the activation of MPF in meiosis, most likely triggered by a decrease in cAMP. |
| hsa05170 | Human immunodeficiency virus 1 infection | Human immunodeficiency virus type 1 (HIV-1) , the causative agent of AIDS (acquired immunodeficiency syndrome), is a lentivirus belonging to the Retroviridae family. The primary cell surface receptor for HIV-1, the CD4 protein, and the co-receptor for HIV-1, either CCR5 or CXCR4, are found on macrophages and T lymphocytes. At the earliest step, sequential binding of virus envelope (Env) glycoprotein gp120 to CD4 and the co-receptor CCR5 or CXCR4 facilitates HIV-1 entry and has the potential to trigger critical signaling that may favor viral replication. At advanced stages of the disease, HIV-1 infection results in dramatic induction of T-cell (CD4+ T and CD8+ T cell) apoptosis both in infected and uninfected bystander T cells, a hallmark of HIV-1 pathogenesis. On the contrary, macrophages are resistant to the cytopathic effect of HIV-1 and produce virus for longer periods of time. |
| hsa05206 | MicroRNAs in cancer | MicroRNA (miRNA) is a cluster of small non-encoding RNA molecules of 21 - 23 nucleotides in length, which controls gene expression post-transcriptionally either via the degradation of target mRNAs or the inhibition of protein translation. Using high-throughput profiling, dysregulation of miRNAs has been widely observed in different stages of cancer. The upregulation (overexpression) of specific miRNAs could lead to the repression of tumor suppressor gene expression, and conversely the downregulation of specific miRNAs could result in an increase of oncogene expression; both these situations induce subsequent malignant effects on cell proliferation, differentiation, and apoptosis that lead to tumor growth and progress. The miRNA signatures of cancer observed in various studies differ significantly. These inconsistencies occur due to the differences in the study populations and methodologies used. This pathway map shows the summarized results from various studies in 9 cancers, each of which is presented in a review article. |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-156711 | Polo-like kinase mediated events. | At mitotic entry, Plk1 phosphorylates and activates Cdc25C phosphatase, whereas it phosphorylates and down-regulates Wee1A (Watanabe et al. 2004). Plk1 also phosphorylates and inhibits Myt1 activity (Sagata 2005). Cyclin B1-bound Cdc2, which is the target of Cdc25C, Wee1A, and Myt1, functions in a feedback loop and phosphorylates the latter components (Cdc25C, Wee1A, Myt1). The Cdc2- dependent phosphorylation provides docking sites for the polo-box domain of Plk1, thus promoting the Plk1-dependent regulation of these components and, as a result, activation of Cdc2-Cyclin B1. PLK1 phosphorylates and activates the transcription factor FOXM1 which stimulates the expression of a number of genes needed for G2/M transition, including PLK1, thereby creating a positive feedback loop (Laoukili et al. 2005, Fu et al. 2008, Sadasivam et al. 2012, Chen et al. 2013) |
| R-HSA-176187 | Activation of ATR in response to replication stress. | Genotoxic stress caused by DNA damage or stalled replication forks can lead to genomic instability. To guard against such instability, genotoxically-stressed cells activate checkpoint factors that halt or slow cell cycle progression. Among the pathways affected are DNA replication by reduction of replication origin firing, and mitosis by inhibiting activation of cyclin-dependent kinases (Cdks). A key factor involved in the response to stalled replication forks is the ATM- and rad3-related (ATR) kinase, a member of the phosphoinositide-3-kinase-related kinase (PIKK) family. Rather than responding to particular lesions in DNA, ATR and its binding partner ATRIP (ATR-interacting protein) sense replication fork stalling indirectly by associating with persistent ssDNA bound by RPA. These structures would be formed, for example, by dissociation of the replicative helicase from the leading or lagging strand DNA polymerase when the polymerase encounters a DNA lesion that blocks DNA synthesis. Along with phosphorylating the downstream transducer kinase Chk1 and the tumor suppressor p53, activated ATR modifies numerous factors that regulate cell cycle progression or the repair of DNA damage. The persistent ssDNA also stimulates recruitment of the RFC-like Rad17-Rfc2-5 alternative clamp-loading complex, which subsequently loads the Rad9-Hus1-Rad1 complex onto the DNA. The latter '9-1-1' complex serves to facilitate Chk1 binding to the stalled replication fork, where Chk1 is phosphorylated by ATR and thereby activated. Upon activation, Chk1 can phosphorylate additional substrates including the Cdc25 family of phosphatases (Cdc25A, Cdc25B, and Cdc25C). These enzymes catalyze the removal of inhibitory phosphate residues from cyclin-dependent kinases (Cdks), allowing their activation. In particular, Cdc25A primarily functions at the G1/S transition to dephosphorylate Cdk2 at Thr 14 and Tyr 15, thus positively regulating the Cdk2-cyclin E complex for S-phase entry. Cdc25A also has mitotic functions. Phosphorylation of Cdc25A at Ser125 by Chk1 leads to Cdc25A ubiquitination and degradation, thus inhibiting DNA replication origin firing. In contrast, Cdc25B and Cdc25C regulate the onset of mitosis through dephosphorylation and activation of Cdk1-cyclin B complexes. In response to replication stress, Chk1 phosphorylates Cdc25B and Cdc25C leading to Cdc25B/C complex formation with 14-3-3 proteins. As these complexes are sequestered in the cytoplasm, they are unable to activate the nuclear Cdk1-cyclin B complex for mitotic entry. These events are outlined in the figure. Persistent single-stranded DNA associated with RPA binds claspin (A) and ATR:ATRIP (B), leading to claspin phosphorylation (C). In parallel, the same single-stranded DNA:RPA complex binds RAD17:RFC (D), enabling the loading of RAD9:HUS1:RAD1 (9-1-1) complex onto the DNA (E). The resulting complex of proteins can then repeatedly bind (F) and phosphorylate (G) CHK1, activating multiple copies of CHK1 |
| R-HSA-5625740 | RHO GTPases activate PKNs. | Protein kinases N (PKN), also known as protein kinase C-related kinases (PKR) feature a C-terminal serine/threonine kinase domain and three RHO-binding motifs at the N-terminus. RHO GTPases RHOA, RHOB, RHOC and RAC1 bind PKN1, PKN2 and PKN3 (Maesaki et al. 1999, Zhong et al. 1999, Owen et al. 2003, Modha et al. 2008, Hutchinson et al. 2011, Hutchinson et al. 2013), bringing them in proximity to the PIP3-activated co-activator PDPK1 (PDK1) (Flynn et al. 2000, Torbett et al. 2003). PDPK1 phosphorylates PKNs on a highly conserved threonine residue in the kinase activation loop, which is a prerequisite for PKN activation. Phosphorylation of other residues might also be involved in activation (Flynn et al. 2000, Torbett et al. 2003, Dettori et al. 2009). PKNs are activated by fatty acids like arachidonic acid and phospholipids in vitro, but the in vivo significance of this activation remains unclear (Palmer et al. 1995, Yoshinaga et al. 1999). PKNs play important roles in diverse functions, including regulation of cell cycle, receptor trafficking, vesicle transport and apoptosis. PKN is also involved in the ligand-dependent transcriptional activation by the androgen receptor. More than 20 proteins and several peptides have been shown to be phosphorylated by PKN1 and PKN2, including CPI-17 (Hamaguchi et al. 2000), alpha-actinin (Mukai et al. 1997), adducin (Collazos et al. 2011), CDC25C (Misaki et al. 2001), vimentin (Matsuzawa et al. 1997), TRAF1 (Kato et al. 2008), CLIP170 (Collazos et al. 2011) and EGFR (Collazos et al. 2011). There are no known substrates for PKN3 (Collazos et al. 2011) |
| R-HSA-6804114 | TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest. | TP53 contributes to the establishment of G2 arrest by inducing transcription of GADD45A and SFN, and by inhibiting transcription of CDC25C. TP53 induces GADD45A transcription in cooperation with chromatin modifying enzymes EP300, PRMT1 and CARM1 (An et al. 2004). GADD45A binds Aurora kinase A (AURKA), inhibiting its catalytic activity and preventing AURKA-mediated G2/M transition (Shao et al. 2006, Sanchez et al. 2010). GADD45A also forms a complex with PCNA. PCNA is involved in both normal and repair DNA synthesis. The effect of GADD45 interaction with PCNA, if any, on S phase progression, G2 arrest and DNA repair is not known (Smith et al. 1994, Hall et al. 1995, Sanchez et al. 2010, Kim et al. 2013). SFN (14-3-3-sigma) is induced by TP53 (Hermeking et al. 1997) and contributes to G2 arrest by binding to the complex of CDK1 and CCNB1 (cyclin B1) and preventing its translocation to the nucleus. Phosphorylation of a number of nuclear proteins by the complex of CDK1 and CCNB1 is needed for G2/M transition (Chan et al. 1999). While promoting G2 arrest, SFN can simultaneously inhibit apoptosis by binding to BAX and preventing its translocation to mitochondria, a step involved in cytochrome C release (Samuel et al. 2001). TP53 binds the promoter of the CDC25C gene in cooperation with the transcriptional repressor E2F4 and represses CDC25C transcription, thus maintaining G2 arrest (St Clair et al. 2004, Benson et al. 2014). The zinc finger transcription factor ZNF385A (HZF) is a direct transcriptional target of TP53 that can form a complex with TP53 and facilitate TP53-mediated induction of SFN transcription (Das et al. 2007) |
| R-HSA-6804115 | TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain. | BTG2 is induced by TP53, leading to cessation of cellular proliferation (Rouault et al. 1996, Duriez et al. 2002). BTG2 binds to the CCR4-NOT complex and promotes mRNA deadenylation activity of this complex. Interaction between BTG2 and CCR4-NOT is needed for the antiproliferative activity of BTG2, but the underlying mechanism has not been elucidated (Rouault et al. 1998, Mauxion et al. 2008, Horiuchi et al. 2009, Doidge et al. 2012, Ezzeddine et al. 2012). Two polo-like kinases, PLK2 and PLK3, are direct transcriptional targets of TP53. TP53-mediated induction of PLK2 may be important for prevention of mitotic catastrophe after spindle damage (Burns et al. 2003). PLK2 is involved in the regulation of centrosome duplication through phosphorylation of centrosome-related proteins CENPJ (Chang et al. 2010) and NPM1 (Krause and Hoffmann 2010). PLK2 is frequently transcriptionally silenced through promoter methylation in B-cell malignancies (Syed et al. 2006). Induction of PLK3 transcription by TP53 (Jen and Cheung 2005) may be important for coordination of M phase events through PLK3-mediated nuclear accumulation of CDC25C (Bahassi et al. 2004). RGCC is induced by TP53 and implicated in cell cycle regulation, possibly through its association with PLK1 (Saigusa et al. 2007). PLAGL1 (ZAC1) is a zinc finger protein directly transcriptionally induced by TP53 (Rozenfeld-Granot et al. 2002). PLAGL1 expression is frequently lost in cancer (Varrault et al. 1998) and PLAGL1 has been implicated in both cell cycle arrest and apoptosis (Spengler et al. 1997), but its mechanism of action remains unknown |
| R-HSA-69273 | Cyclin A/B1/B2 associated events during G2/M transition. | Cell cycle progression is regulated by cyclin-dependent protein kinases at both the G1/S and the G2/M transitions. The G2/M transition is regulated through the phosphorylation of nuclear lamins and histones (reviewed in Sefton, 2001).The two B-type cyclins localize to different regions within the cell and are thought to have specific roles as CDK1-activating subunits (see Bellanger et al., 2007). Cyclin B1 is primarily cytoplasmic during interphase and translocates into the nucleus at the onset of mitosis (Jackman et al., 1995; Hagting et al., 1999). Cyclin B2 colocalizes with the Golgi apparatus and contributes to its fragmentation during mitosis (Jackman et al., 1995; Draviam et al., 2001) |
| R-HSA-75035 | Chk1/Chk2(Cds1) mediated inactivation of Cyclin B:Cdk1 complex. | DNA damage induced activation of the checkpoint kinases Chk1/Chk2(Cds1) results in the conversion and/or maintenance of CyclinB:Cdc2 complex in its Tyrosine 15 phosphorylated (inactive) state. Cdc2 activity is regulated by a balance between the phosphorylation and dephosphorylation by the Wee1/Myt1 kinase and Cdc25 phosphatase. Inactivation of the Cyclin B:Cdc2 complex likely involves both inactivation of Cdc25 and/or stimulation of Wee1/Myt1 kinase activity |
| R-HSA-8862803 | Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models. | Post-mitotic neurons do not have an active cell cycle. However, deregulation of Cyclin Dependent Kinase-5 (CDK5) activity in these neurons can aberrantly activate various components of cell cycle leading to neuronal death (Chang et al. 2012). Random activation of cell cycle proteins has been shown to play a key role in the pathogenesis of several neurodegenerative disorders (Yang et al. 2003, Lopes et al. 2009). CDK5 is not activated by the canonical cyclins, but binds to its own specific partners, CDK5R1 and CDK5R2 (aka p35 and p39, respectively) (Tsai et al. 1994, Tang et al. 1995). Expression of p35 is nearly ubiquitous, whereas p39 is largely expressed in the central nervous system. A variety of neurotoxic insults such as beta-amyloid (A-beta), ischemia, excitotoxicity and oxidative stress disrupt the intracellular calcium homeostasis in neurons, thereby leading to the activation of calpain, which cleaves p35 into p25 and p10 (Lee et al. 2000). p25 has a six-fold longer half-life compared to p35 and lacks the membrane anchoring signal, which results in its constitutive activation and mislocalization of the CDK5:p25 complex to the cytoplasm and the nucleus. There, CDK5:p25 is able to access and phosphorylate a variety of atypical targets, triggering a cascade of neurotoxic pathways that culminate in neuronal death. One such neurotoxic pathway involves CDK5-mediated random activation of cell cycle proteins which culminate in neuronal death. Exposure of primary cortical neurons to oligomeric beta-amyloid (1-42) hyper-activates CDK5 due to p25 formation, which in turn phosphorylates CDC25A, CDC25B and CDC25C. CDK5 phosphorylates CDC25A at S40, S116 and S261; CDC25B at S50, T69, S160, S321 and S470; and CDC25C at T48, T67, S122, T130, S168 and S214. CDK5-mediated phosphorylation of CDC25A, CDC25B and CDC25C not only increases their phosphatase activities but also facilitates their release from 14-3-3 inhibitory binding. CDC25A, CDC25B and CDC25C in turn activate CDK1, CDK2 and CDK4 kinases causing neuronal death. Consistent with this mechanism, higher CDC25A, CDC25B and CDC25C activities were observed in human Alzheimer's disease (AD) clinical samples, as compared to age-matched controls |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| BRCA1 | Biochemical Activity | physical | 23246971, (Europe PMC) | NA | BioGRID |
| BRSK2 | Biochemical Activity | physical | 15150265, (Europe PMC) | NA | BioGRID |
| CAMSAP2 | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| CBY1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| CCNB1 | Reconstituted Complex | physical | 10864927, (Europe PMC) | NA | BioGRID |
| CCNB2 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| CCT8L1P | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CDC25C | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CDC37 | Affinity Capture-MS, Affinity Capture-Western, pull down | association, physical | 17525741, 27432908, 28330616, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDK1 | Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical, physical association | 10864927, 17349584, 27880917, (Europe PMC) | 0.50 | BioGRID, IntAct |
| CDK2 | Biochemical Activity | physical | 16191191, 8475101, (Europe PMC) | NA | BioGRID |
| CDK5 | Biochemical Activity | physical | 22899714, (Europe PMC) | NA | BioGRID |
| CDS1 | Biochemical Activity | physical | 10681541, (Europe PMC) | NA | BioGRID |
| CGN | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| CHEK1 | Biochemical Activity, Reconstituted Complex, protein kinase assay | phosphorylation reaction, physical | 10681541, 11016625, 11390642, 11836499, 12660173, 15705874, 16330544, 16705183, 17035231, 19330022, 9278511, (Europe PMC) | 0.62 | BioGRID, IntAct |
| CHEK2 | Biochemical Activity | physical | 10744722, 11053450, 11438675, 12024051, 12402044, 12909615, 16311512, 16705183, 25361978, (Europe PMC) | NA | BioGRID |
| CSNK2A2 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CTBP2 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| DCLK1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| DENND1A | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| DENND4C | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| DYNLT1 | Proximity Label-MS | physical | 26638075, (Europe PMC) | NA | BioGRID |
| EGFR | Affinity Capture-Luminescence, PCA, Two-hybrid, ubiquitin reconstruction | physical, physical association | 24658140, 25402006, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EIF4E2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| ERBB3 | Two-hybrid | physical | 28065597, (Europe PMC) | NA | BioGRID |
| ERBB4 | Two-hybrid | physical | 28065597, (Europe PMC) | NA | BioGRID |
| FAM27E3 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| GIGYF1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| GIGYF2 | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| GLO1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| GRPEL1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| HDAC4 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| HERC2 | Affinity Capture-MS | physical | 25476789, (Europe PMC) | NA | BioGRID |
| HSP90AA1 | Affinity Capture-Western | physical | 17525741, (Europe PMC) | NA | BioGRID |
| HSPA4 | Affinity Capture-Western | physical | 17525741, (Europe PMC) | NA | BioGRID |
| HSPBP1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| ILK | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| INPP5E | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KCTD3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KIF13B | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KIF1C | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KSR1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| LIMA1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| LMTK2 | Two-hybrid | physical | 28065597, (Europe PMC) | NA | BioGRID |
| LPIN3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| LRFN1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| MAGI1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| MAP3K21 | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| MAPK1 | Affinity Capture-Western, Reconstituted Complex | physical | 16582626, (Europe PMC) | NA | BioGRID |
| MAPK14 | Biochemical Activity, Reconstituted Complex | physical | 11333986, (Europe PMC) | NA | BioGRID |
| MAPK3 | Affinity Capture-Western, Reconstituted Complex | physical | 16582626, (Europe PMC) | NA | BioGRID |
| MAPK9 | Biochemical Activity | physical | 15629715, (Europe PMC) | NA | BioGRID |
| MAPKAP1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| MARK3 | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex | physical | 12941695, 15319445, 16968750, 9543386, (Europe PMC) | NA | BioGRID |
| MAST3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| NADK | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| NAV1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| NEDD4 | Affinity Capture-Western, Protein-peptide | physical | 10037602, (Europe PMC) | NA | BioGRID |
| NF1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| OSBPL6 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| PCNA | Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 11559705, 11896603, (Europe PMC) | NA | BioGRID |
| PHLDB2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| PHLDB3 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| PIN1 | Affinity Capture-Western, Far Western, Protein-peptide | physical | 10037602, 11604498, 9499405, (Europe PMC) | NA | BioGRID |
| PKN1 | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex | physical | 15791647, (Europe PMC) | NA | BioGRID |
| PLEKHA7 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| PLK1 | Affinity Capture-Western, Biochemical Activity, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, classical fluorescence spectroscopy, coimmunoprecipitation, isothermal titration calorimetry, pull down, x-ray crystallography | direct interaction, physical, physical association | 11202906, 12595692, 14532005, 17307877, 19503101, 19597481, (Europe PMC) | 0.86 | BioGRID, IntAct, MINT |
| PLK3 | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex | physical | 10557092, (Europe PMC) | NA | BioGRID |
| PPM1H | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| PTPN13 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| RALGPS2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| RASAL2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| ROR2 | Two-hybrid | physical | 28065597, (Europe PMC) | NA | BioGRID |
| RPS27A | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| RTKN | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| SCO2 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| SFN | Affinity Capture-Western | physical | 15791647, (Europe PMC) | NA | BioGRID |
| SH3PXD2A | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SH3RF3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SHC1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| SIPA1L1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SLIRP | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| SRGAP2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SRSF12 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| STARD13 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| STIP1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| SUFU | Affinity Capture-MS | physical | 27432908, 27880917, 28514442, (Europe PMC) | NA | BioGRID |
| SYDE1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| TANC2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| TESK2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| TIAM1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| TPP1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| USP17L2 | Affinity Capture-Western | physical | 20228808, (Europe PMC) | NA | BioGRID |
| YWHAB | Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down | association, physical, physical association | 10681541, 15284440, 15791647, 16205633, 19470455, 24255178, 27880917, 28330616, (Europe PMC) | 0.67 | BioGRID, IntAct |
| YWHAE | Affinity Capture-MS, Affinity Capture-Western, pull down | association, physical | 10330186, 10681541, 15791647, 19331823, 27880917, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| YWHAG | Affinity Capture-MS, Affinity Capture-Western, pull down | association, physical | 15791647, 27432908, 27880917, 28330616, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAH | Affinity Capture-MS, Affinity Capture-Western, pull down | association, physical | 11969417, 15791647, 27432908, 27880917, 28330616, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAQ | Affinity Capture-MS, Affinity Capture-Western | physical | 15629715, 15791647, 27880917, (Europe PMC) | NA | BioGRID |
| YWHAZ | Affinity Capture-MS, Affinity Capture-Western, pull down | physical, physical association | 10681541, 15161933, 15791647, 27880917, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| ZBTB21 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| ZNF638 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| CDC37 | Affinity Capture-MS, Affinity Capture-Western, pull down | association, physical | 17525741, 27432908, 28330616, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDK1 | Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical, physical association | 10864927, 17349584, 27880917, (Europe PMC) | 0.50 | BioGRID, IntAct |
| CGN | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| CHEK1 | Biochemical Activity, Reconstituted Complex, protein kinase assay | phosphorylation reaction, physical | 10681541, 11016625, 11390642, 11836499, 12660173, 15705874, 16330544, 16705183, 17035231, 19330022, 9278511, (Europe PMC) | 0.62 | BioGRID, IntAct |
| DCLK1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| DENND4C | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| EGFR | Affinity Capture-Luminescence, PCA, Two-hybrid, ubiquitin reconstruction | physical, physical association | 24658140, 25402006, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EIF4E2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| FAM20C | protein kinase assay | phosphorylation reaction | 22582013, (Europe PMC) | 0.44 | IntAct |
| GIGYF1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| HDAC4 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| INPP5E | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KCTD3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KIF13B | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KIF1C | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KSR1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| LIMA1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| LPIN3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| LRFN1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| LZTS1 | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | association, physical association | 17349584, (Europe PMC) | 0.50 | IntAct |
| MAGI1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| MAPKAP1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| MAST3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| MYO1B | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| MYO1C | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| NADK | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| NAV1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| NF1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| OSBPL6 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| PHLDB2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| PLEKHA7 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| PLK1 | Affinity Capture-Western, Biochemical Activity, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, classical fluorescence spectroscopy, coimmunoprecipitation, isothermal titration calorimetry, pull down, x-ray crystallography | direct interaction, physical, physical association | 11202906, 12595692, 14532005, 17307877, 19503101, 19597481, (Europe PMC) | 0.86 | BioGRID, IntAct, MINT |
| PPM1H | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| PPP2R5D | anti tag coimmunoprecipitation | physical association | 17110335, 18056802, (Europe PMC) | 0.59 | IntAct |
| PTPN13 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| RALGPS2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| RASAL2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SH3PXD2A | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SH3RF3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SIPA1L1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SRGAP2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SRSF12 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| STARD13 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SYDE1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| TANC2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| TCTE1 | proximity-dependent biotin identification | association | 26638075, (Europe PMC) | 0.35 | IntAct |
| TESK2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| TIAM1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| TPM4 | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| YWHAB | Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down | association, physical, physical association | 10681541, 15284440, 15791647, 16205633, 19470455, 24255178, 27880917, 28330616, (Europe PMC) | 0.67 | BioGRID, IntAct |
| YWHAE | Affinity Capture-MS, Affinity Capture-Western, pull down | association, physical | 10330186, 10681541, 15791647, 19331823, 27880917, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| YWHAG | Affinity Capture-MS, Affinity Capture-Western, pull down | association, physical | 15791647, 27432908, 27880917, 28330616, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAH | Affinity Capture-MS, Affinity Capture-Western, pull down | association, physical | 11969417, 15791647, 27432908, 27880917, 28330616, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAZ | Affinity Capture-MS, Affinity Capture-Western, pull down | physical, physical association | 10681541, 15161933, 15791647, 27880917, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| ZBTB21 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| ZNF638 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| YWHAE | Affinity Capture-MS, Affinity Capture-Western, pull down | association, physical | 10330186, 10681541, 15791647, 19331823, 27880917, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| YWHAZ | Affinity Capture-MS, Affinity Capture-Western, pull down | physical, physical association | 10681541, 15161933, 15791647, 27880917, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| BRCA1 | Biochemical Activity | physical | 23246971, (Europe PMC) | NA | BioGRID |
| BRSK2 | Biochemical Activity | physical | 15150265, (Europe PMC) | NA | BioGRID |
| CAMSAP2 | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| CBY1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| CCNB1 | Reconstituted Complex | physical | 10864927, (Europe PMC) | NA | BioGRID |
| CCNB2 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| CCT8L1P | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CDC25C | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CDC37 | Affinity Capture-MS, Affinity Capture-Western, pull down | association, physical | 17525741, 27432908, 28330616, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDK1 | Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical, physical association | 10864927, 17349584, 27880917, (Europe PMC) | 0.50 | BioGRID, IntAct |
| CDK2 | Biochemical Activity | physical | 16191191, 8475101, (Europe PMC) | NA | BioGRID |
| CDK5 | Biochemical Activity | physical | 22899714, (Europe PMC) | NA | BioGRID |
| CDS1 | Biochemical Activity | physical | 10681541, (Europe PMC) | NA | BioGRID |
| CGN | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| CHEK1 | Biochemical Activity, Reconstituted Complex, protein kinase assay | phosphorylation reaction, physical | 10681541, 11016625, 11390642, 11836499, 12660173, 15705874, 16330544, 16705183, 17035231, 19330022, 9278511, (Europe PMC) | 0.62 | BioGRID, IntAct |
| CHEK2 | Biochemical Activity | physical | 10744722, 11053450, 11438675, 12024051, 12402044, 12909615, 16311512, 16705183, 25361978, (Europe PMC) | NA | BioGRID |
| CSNK2A2 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CTBP2 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| DCLK1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| DENND1A | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| DENND4C | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| DYNLT1 | Proximity Label-MS | physical | 26638075, (Europe PMC) | NA | BioGRID |
| EGFR | Affinity Capture-Luminescence, PCA, Two-hybrid, ubiquitin reconstruction | physical, physical association | 24658140, 25402006, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EIF4E2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| ERBB3 | Two-hybrid | physical | 28065597, (Europe PMC) | NA | BioGRID |
| ERBB4 | Two-hybrid | physical | 28065597, (Europe PMC) | NA | BioGRID |
| FAM20C | protein kinase assay | phosphorylation reaction | 22582013, (Europe PMC) | 0.44 | IntAct |
| FAM27E3 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| GIGYF1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| GIGYF2 | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| GLO1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| GRPEL1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| HDAC4 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| HERC2 | Affinity Capture-MS | physical | 25476789, (Europe PMC) | NA | BioGRID |
| HSP90AA1 | Affinity Capture-Western | physical | 17525741, (Europe PMC) | NA | BioGRID |
| HSPA4 | Affinity Capture-Western | physical | 17525741, (Europe PMC) | NA | BioGRID |
| HSPBP1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| ILK | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| INPP5E | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KCTD3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KIF13B | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KIF1C | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KSR1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| LIMA1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| LMTK2 | Two-hybrid | physical | 28065597, (Europe PMC) | NA | BioGRID |
| LPIN3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| LRFN1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| LZTS1 | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | association, physical association | 17349584, (Europe PMC) | 0.50 | IntAct |
| MAGI1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| MAP3K21 | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| MAPK1 | Affinity Capture-Western, Reconstituted Complex | physical | 16582626, (Europe PMC) | NA | BioGRID |
| MAPK14 | Biochemical Activity, Reconstituted Complex | physical | 11333986, (Europe PMC) | NA | BioGRID |
| MAPK3 | Affinity Capture-Western, Reconstituted Complex | physical | 16582626, (Europe PMC) | NA | BioGRID |
| MAPK9 | Biochemical Activity | physical | 15629715, (Europe PMC) | NA | BioGRID |
| MAPKAP1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| MARK3 | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex | physical | 12941695, 15319445, 16968750, 9543386, (Europe PMC) | NA | BioGRID |
| MAST3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| MYO1B | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| MYO1C | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| NADK | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| NAV1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| NEDD4 | Affinity Capture-Western, Protein-peptide | physical | 10037602, (Europe PMC) | NA | BioGRID |
| NF1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| OSBPL6 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| PCNA | Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 11559705, 11896603, (Europe PMC) | NA | BioGRID |
| PHLDB2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| PHLDB3 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| PIN1 | Affinity Capture-Western, Far Western, Protein-peptide | physical | 10037602, 11604498, 9499405, (Europe PMC) | NA | BioGRID |
| PKN1 | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex | physical | 15791647, (Europe PMC) | NA | BioGRID |
| PLEKHA7 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| PLK1 | Affinity Capture-Western, Biochemical Activity, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, classical fluorescence spectroscopy, coimmunoprecipitation, isothermal titration calorimetry, pull down, x-ray crystallography | direct interaction, physical, physical association | 11202906, 12595692, 14532005, 17307877, 19503101, 19597481, (Europe PMC) | 0.86 | BioGRID, IntAct, MINT |
| PLK3 | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex | physical | 10557092, (Europe PMC) | NA | BioGRID |
| PPM1H | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| PPP2R5D | anti tag coimmunoprecipitation | physical association | 17110335, 18056802, (Europe PMC) | 0.59 | IntAct |
| PTPN13 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| RALGPS2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| RASAL2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| ROR2 | Two-hybrid | physical | 28065597, (Europe PMC) | NA | BioGRID |
| RPS27A | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| RTKN | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| SCO2 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| SFN | Affinity Capture-Western | physical | 15791647, (Europe PMC) | NA | BioGRID |
| SH3PXD2A | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SH3RF3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SHC1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| SIPA1L1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SLIRP | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| SRGAP2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SRSF12 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| STARD13 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| STIP1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| SUFU | Affinity Capture-MS | physical | 27432908, 27880917, 28514442, (Europe PMC) | NA | BioGRID |
| SYDE1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| TANC2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| TCTE1 | proximity-dependent biotin identification | association | 26638075, (Europe PMC) | 0.35 | IntAct |
| TESK2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| TIAM1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| TPM4 | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| TPP1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| USP17L2 | Affinity Capture-Western | physical | 20228808, (Europe PMC) | NA | BioGRID |
| YWHAB | Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down | association, physical, physical association | 10681541, 15284440, 15791647, 16205633, 19470455, 24255178, 27880917, 28330616, (Europe PMC) | 0.67 | BioGRID, IntAct |
| YWHAE | Affinity Capture-MS, Affinity Capture-Western, pull down | association, physical | 10330186, 10681541, 15791647, 19331823, 27880917, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| YWHAG | Affinity Capture-MS, Affinity Capture-Western, pull down | association, physical | 15791647, 27432908, 27880917, 28330616, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAH | Affinity Capture-MS, Affinity Capture-Western, pull down | association, physical | 11969417, 15791647, 27432908, 27880917, 28330616, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAQ | Affinity Capture-MS, Affinity Capture-Western | physical | 15629715, 15791647, 27880917, (Europe PMC) | NA | BioGRID |
| YWHAZ | Affinity Capture-MS, Affinity Capture-Western, pull down | physical, physical association | 10681541, 15161933, 15791647, 27880917, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| ZBTB21 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| ZNF638 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |