Top
CDC25B
Localization (UniProt annotation) Cytoplasm, cytoskeleton, microtubuleorganizing center, centrosome Cytoplasm, cytoskeleton, spindle pole Function (UniProt annotation) Tyrosine protein phosphatase which functions as adosage-dependent inducer of mitotic progression Required for G2/Mphases of the cell cycle progression and abscission duringcytokinesis in a ECT2-dependent manner Directly dephosphorylatesCDK1 and stimulates its kinase activity The three isoforms seemto have a different level of activity Catalytic Activity (UniProt annotation) Protein tyrosine phosphate + H(2)O = proteintyrosine + phosphate Protein Sequence MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASSPVTTLTQTMHDLAGLGSETPKSQVGTLLFR
SRSRLTHLSLSRRASESSLSSESSESSDAGLCMDSPSPMDPHMAEQTFEQAIQAASRIIRNEQFAIRRFQSMPVRLLGHS
PVLRNITNSQAPDGRRKSEAGSGAASSSGEDKENDGFVFKMPWKPTHPSSTHALAEWASRREAFAQRPSSAPDLMCLSPD
RKMEVEELSPLALGRFSLTPAEGDTEEDDGFVDILESDLKDDDAVPPGMESLISAPLVKTLEKEEEKDLVMYSKCQRLFR
SPSMPCSVIRPILKRLERPQDRDTPVQNKRRRSVTPPEEQQEAEEPKARVLRSKSLCHDEIENLLDSDHRELIGDYSKAF
LLQTVDGKHQDLKYISPETMVALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPCSLDKR
VILIFHCEFSSERGPRMCRFIRERDRAVNDYPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRPMNHEAFKDELKTFRLK
TRSWAGERSRRELCSRLQDQ
ELM Motif Motif Instance
Description Motif Regex NA NA NA NA
CDC25B is dephosphorylated by following phosphatases:
Pathway ID Pathway Name Pathway Description (KEGG) hsa04010 MAPK signaling pathway The mitogen-activated protein kinase (MAPK) cascade is a highly conserved module that is involved in various cellular functions, including cell proliferation, differentiation and migration. Mammals express at least four distinctly regulated groups of MAPKs, extracellular signal-related kinases (ERK)-1/2, Jun amino-terminal kinases (JNK1/2/3), p38 proteins (p38alpha/beta/gamma/delta) and ERK5, that are activated by specific MAPKKs: MEK1/2 for ERK1/2, MKK3/6 for the p38, MKK4/7 (JNKK1/2) for the JNKs, and MEK5 for ERK5. Each MAPKK, however, can be activated by more than one MAPKKK, increasing the complexity and diversity of MAPK signalling. Presumably each MAPKKK confers responsiveness to distinct stimuli. For example, activation of ERK1/2 by growth factors depends on the MAPKKK c-Raf, but other MAPKKKs may activate ERK1/2 in response to pro-inflammatory stimuli. hsa04110 Cell cycle Mitotic cell cycle progression is accomplished through a reproducible sequence of events, DNA replication (S phase) and mitosis (M phase) separated temporally by gaps known as G1 and G2 phases. Cyclin-dependent kinases (CDKs) are key regulatory enzymes, each consisting of a catalytic CDK subunit and an activating cyclin subunit. CDKs regulate the cell's progression through the phases of the cell cycle by modulating the activity of key substrates. Downstream targets of CDKs include transcription factor E2F and its regulator Rb. Precise activation and inactivation of CDKs at specific points in the cell cycle are required for orderly cell division. Cyclin-CDK inhibitors (CKIs), such as p16Ink4a, p15Ink4b, p27Kip1, and p21Cip1, are involved in the negative regulation of CDK activities, thus providing a pathway through which the cell cycle is negatively regulated.Eukaryotic cells respond to DNA damage by activating signaling pathways that promote cell cycle arrest and DNA repair. In response to DNA damage, the checkpoint kinase ATM phosphorylates and activates Chk2, which in turn directly phosphorylates and activates p53 tumor suppressor protein. p53 and its transcriptional targets play an important role in both G1 and G2 checkpoints. ATR-Chk1-mediated protein degradation of Cdc25A protein phosphatase is also a mechanism conferring intra-S-phase checkpoint activation. hsa04914 Progesterone-mediated oocyte maturation Xenopus oocytes are naturally arrested at G2 of meiosis I. Exposure to either insulin/IGF-1 or the steroid hormone progesterone breaks this arrest and induces resumption of the two meiotic division cycles and maturation of the oocyte into a mature, fertilizable egg. This process is termed oocyte maturation. The transition is accompanied by an increase in maturation promoting factor (MPF or Cdc2/cyclin B) which precedes germinal vesicle breakdown (GVBD). Most reports point towards the Mos-MEK1-ERK2 pathway [where ERK is an extracellular signal-related protein kinase, MEK is a MAPK/ERK kinase and Mos is a p42(MAPK) activator] and the polo-like kinase/CDC25 pathway as responsible for the activation of MPF in meiosis, most likely triggered by a decrease in cAMP. hsa05206 MicroRNAs in cancer MicroRNA (miRNA) is a cluster of small non-encoding RNA molecules of 21 - 23 nucleotides in length, which controls gene expression post-transcriptionally either via the degradation of target mRNAs or the inhibition of protein translation. Using high-throughput profiling, dysregulation of miRNAs has been widely observed in different stages of cancer. The upregulation (overexpression) of specific miRNAs could lead to the repression of tumor suppressor gene expression, and conversely the downregulation of specific miRNAs could result in an increase of oncogene expression; both these situations induce subsequent malignant effects on cell proliferation, differentiation, and apoptosis that lead to tumor growth and progress. The miRNA signatures of cancer observed in various studies differ significantly. These inconsistencies occur due to the differences in the study populations and methodologies used. This pathway map shows the summarized results from various studies in 9 cancers, each of which is presented in a review article.
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-69273 Cyclin A/B1/B2 associated events during G2/M transition. Cell cycle progression is regulated by cyclin-dependent protein kinases at both the G1/S and the G2/M transitions. The G2/M transition is regulated through the phosphorylation of nuclear lamins and histones (reviewed in Sefton, 2001).The two B-type cyclins localize to different regions within the cell and are thought to have specific roles as CDK1-activating subunits (see Bellanger et al., 2007). Cyclin B1 is primarily cytoplasmic during interphase and translocates into the nucleus at the onset of mitosis (Jackman et al., 1995; Hagting et al., 1999). Cyclin B2 colocalizes with the Golgi apparatus and contributes to its fragmentation during mitosis (Jackman et al., 1995; Draviam et al., 2001) R-HSA-69656 Cyclin A:Cdk2-associated events at S phase entry. Cyclin A:Cdk2 plays a key role in S phase entry by phosphorylation of proteins including Cdh1, Rb, p21 and p27. During G1 phase of the cell cycle, cyclin A is synthesized and associates with Cdk2. After forming in the cytoplasm, the Cyclin A:Cdk2 complexes are translocated to the nucleus (Jackman et al.,2002). Prior to S phase entry, the activity of Cyclin A:Cdk2 complexes is negatively regulated through Tyr 15 phosphorylation of Cdk2 (Gu et al., 1995) and also by the association of the cyclin kinase inhibitors (CKIs), p27 and p21. Phosphorylation of cyclin-dependent kinases (CDKs) by the CDK-activating kinase (CAK) is required for the activation of the CDK2 kinase activity (Aprelikova et al., 1995). The entry into S phase is promoted by the removal of inhibitory Tyr 15 phosphates from the Cdk2 subunit of Cyclin A:Cdk2 complex by the Cdc25 phosphatases (Blomberg and Hoffmann, 1999) and by SCF(Skp2)-mediated degradation of p27/p21 (see Ganoth et al., 2001). \r\nWhile Cdk2 is thought to play a primary role in regulating entry into S phase, recent evidence indicates that Cdk1 is equally capable of promoting entry into S phase and the initiation of DNA replication (see Bashir and Pagano, 2005). Thus, Cdk1 complexes may also play a significant role at this point in the cell cycle R-HSA-8862803 Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models. Post-mitotic neurons do not have an active cell cycle. However, deregulation of Cyclin Dependent Kinase-5 (CDK5) activity in these neurons can aberrantly activate various components of cell cycle leading to neuronal death (Chang et al. 2012). Random activation of cell cycle proteins has been shown to play a key role in the pathogenesis of several neurodegenerative disorders (Yang et al. 2003, Lopes et al. 2009). CDK5 is not activated by the canonical cyclins, but binds to its own specific partners, CDK5R1 and CDK5R2 (aka p35 and p39, respectively) (Tsai et al. 1994, Tang et al. 1995). Expression of p35 is nearly ubiquitous, whereas p39 is largely expressed in the central nervous system. A variety of neurotoxic insults such as beta-amyloid (A-beta), ischemia, excitotoxicity and oxidative stress disrupt the intracellular calcium homeostasis in neurons, thereby leading to the activation of calpain, which cleaves p35 into p25 and p10 (Lee et al. 2000). p25 has a six-fold longer half-life compared to p35 and lacks the membrane anchoring signal, which results in its constitutive activation and mislocalization of the CDK5:p25 complex to the cytoplasm and the nucleus. There, CDK5:p25 is able to access and phosphorylate a variety of atypical targets, triggering a cascade of neurotoxic pathways that culminate in neuronal death. One such neurotoxic pathway involves CDK5-mediated random activation of cell cycle proteins which culminate in neuronal death. Exposure of primary cortical neurons to oligomeric beta-amyloid (1-42) hyper-activates CDK5 due to p25 formation, which in turn phosphorylates CDC25A, CDC25B and CDC25C. CDK5 phosphorylates CDC25A at S40, S116 and S261; CDC25B at S50, T69, S160, S321 and S470; and CDC25C at T48, T67, S122, T130, S168 and S214. CDK5-mediated phosphorylation of CDC25A, CDC25B and CDC25C not only increases their phosphatase activities but also facilitates their release from 14-3-3 inhibitory binding. CDC25A, CDC25B and CDC25C in turn activate CDK1, CDK2 and CDK4 kinases causing neuronal death. Consistent with this mechanism, higher CDC25A, CDC25B and CDC25C activities were observed in human Alzheimer's disease (AD) clinical samples, as compared to age-matched controls
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AFDN Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID AGAP1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct ANKRD34A Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct AR Reconstituted Complex physical 12569365 , (Europe PMC )NA BioGRID BRSK2 Biochemical Activity physical 15150265 , (Europe PMC )NA BioGRID BTRC Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Proximity Label-MS, Reconstituted Complex physical 15845771 , 21807946 , 25332235 , 25900982 , 26091241 , 26496610 , 27880917 , 28514442 , (Europe PMC )NA BioGRID CALU Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID CAMSAP2 Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID CBY1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct CCDC28A Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID CCNB1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID CDC14A Affinity Capture-Western, Biochemical Activity physical 20956543 , (Europe PMC )NA BioGRID CDC20 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID CDC25B Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID CDC5L Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CDK1 Affinity Capture-Western physical 11516829 , (Europe PMC )NA BioGRID CDK16 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct CDK2 Biochemical Activity, Two-hybrid, two hybrid physical, physical association 16191191 , 7644510 , 9840943 , (Europe PMC )0.37 BioGRID, IntAct CDK3 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID CDK5 Affinity Capture-Western, Biochemical Activity physical 11516829 , 22899714 , (Europe PMC )NA BioGRID CENPB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CGN Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct CHEK1 Biochemical Activity, Reconstituted Complex physical 9278511 , (Europe PMC )NA BioGRID CSNK2A1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 12527891 , (Europe PMC )NA BioGRID CUL1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID DCLK1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct DENND1A Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID DENND4C Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct DEPDC1B Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct EDC3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct EIF4B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct EIF4E2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct ESR1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 11689696 , (Europe PMC )NA BioGRID FAM110A Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct FAM110B Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct FAM53C Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID FBXW11 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, anti tag coimmunoprecipitation association, physical, physical association 19615732 , 21807946 , 22017875 , 25332235 , 25515538 , 25900982 , 26496610 , 27432908 , 27880917 , 28514442 , 29150431 , (Europe PMC )0.35, 0.40 BioGRID, IntAct FOXM1 Affinity Capture-Western physical 15024056 , (Europe PMC )NA BioGRID GAB2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct GIGYF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct HDAC4 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct KAT2B Reconstituted Complex physical 11689696 , (Europe PMC )NA BioGRID KCTD3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct KIF13B Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct KIF1C Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct KRT31 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct KRT35 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct KRT85 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct KSR1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct LIMA1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct LRFN1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct MAGI1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct MAP3K21 Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID MAPK14 Biochemical Activity, Reconstituted Complex physical 11333986 , (Europe PMC )NA BioGRID MAPK1IP1L Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID MAPK9 Biochemical Activity physical 15629715 , (Europe PMC )NA BioGRID MAPKAP1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct MAPKAPK2 Biochemical Activity physical 15629715 , (Europe PMC )NA BioGRID MAST3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct MELK Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, inference by socio-affinity scoring physical, physical association 12400006 , 27173435 , (Europe PMC )0.27 BioGRID, IntAct NADK Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct NAV1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct NF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PGR Reconstituted Complex physical 11689696 , (Europe PMC )NA BioGRID PHB2 Affinity Capture-MS physical 17353931 , (Europe PMC )NA BioGRID PHLDB2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PLEKHA5 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PLEKHA7 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PPM1F Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PPM1H Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PRMT1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID PSME3 Affinity Capture-MS, two hybrid array, two hybrid prey pooling approach physical, physical association 27432908 , (Europe PMC )0.49 BioGRID, IntAct RAB3IP Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID RASAL2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct RCN1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID RTKN Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID SH3BP4 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct SH3PXD2A Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct SIPA1L1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct SKP1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID SRGAP2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct SRSF12 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct STK39 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID SYDE1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct TBC1D25 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct TESK2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct TIAM1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct USP21 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct WDR6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct XPO1 Affinity Capture-MS physical 26673895 , (Europe PMC )NA BioGRID YWHAB Affinity Capture-MS, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, coimmunoprecipitation, two hybrid association, physical, physical association 10713667 , 12871587 , 15173315 , 16672277 , 26496610 , 27432908 , 7644510 , (Europe PMC )0.35, 0.40, 0.86 BioGRID, IntAct, MINT YWHAE Affinity Capture-MS, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, two hybrid physical, physical association 10713667 , 12871587 , 15173315 , 27432908 , 27880917 , 7644510 , (Europe PMC )0.40, 0.57 BioGRID, IntAct, MINT YWHAG Affinity Capture-MS, anti tag coimmunoprecipitation, coimmunoprecipitation association, physical 16672277 , 26496610 , 27432908 , (Europe PMC )0.53 BioGRID, IntAct, MINT YWHAH Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, coimmunoprecipitation, two hybrid association, physical, physical association 10713667 , 16672277 , 26496610 , 27432908 , (Europe PMC )0.72 BioGRID, IntAct, MINT YWHAQ Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation association, physical 10713667 , 15629715 , 26496610 , (Europe PMC )0.35 BioGRID, IntAct YWHAZ Affinity Capture-MS, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, coimmunoprecipitation, pull down, two hybrid association, direct interaction, physical, physical association 10713667 , 12764136 , 12766774 , 15629715 , 16672277 , 26496610 , 27432908 , 28514442 , (Europe PMC )0.89 BioGRID, IntAct, MINT ZBTB21 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct ZNF638 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ANKRD34A Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct CBY1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct CDC5L Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CDK16 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct CDK2 Biochemical Activity, Two-hybrid, two hybrid physical, physical association 16191191 , 7644510 , 9840943 , (Europe PMC )0.37 BioGRID, IntAct CENPB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CGN Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct DCLK1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct DENND4C Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct DEPDC1B Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct DOCK2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EDC3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct EIF4B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct EIF4E2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct FAM110A Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct FAM110B Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct FBXW11 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, anti tag coimmunoprecipitation association, physical, physical association 19615732 , 21807946 , 22017875 , 25332235 , 25515538 , 25900982 , 26496610 , 27432908 , 27880917 , 28514442 , 29150431 , (Europe PMC )0.35, 0.40 BioGRID, IntAct GAB2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct GIGYF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct HDAC4 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct KCTD3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct KIF13B Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct KIF1C Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct KRT31 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct KRT35 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct KRT85 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct KSR1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct LIMA1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct LRFN1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct MAGI1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct MAPKAP1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct MAST3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct MELK Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, inference by socio-affinity scoring physical, physical association 12400006 , 27173435 , (Europe PMC )0.27 BioGRID, IntAct NADK Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct NAV1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct NF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PHB2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PHLDB2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PLEKHA5 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PLEKHA7 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PPM1H Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PSME3 Affinity Capture-MS, two hybrid array, two hybrid prey pooling approach physical, physical association 27432908 , (Europe PMC )0.49 BioGRID, IntAct RASAL2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct SFN anti tag coimmunoprecipitation, coimmunoprecipitation association, physical association 15173315 , 16672277 , (Europe PMC )0.40, 0.56 IntAct, MINT SH3BP4 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct SH3PXD2A Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct SIPA1L1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct SRGAP2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct SRSF12 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct SYDE1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct TBC1D25 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct TESK2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct TIAM1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct USP21 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct WDR6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct YWHAB Affinity Capture-MS, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, coimmunoprecipitation, two hybrid association, physical, physical association 10713667 , 12871587 , 15173315 , 16672277 , 26496610 , 27432908 , 7644510 , (Europe PMC )0.35, 0.40, 0.86 BioGRID, IntAct, MINT YWHAE Affinity Capture-MS, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, two hybrid physical, physical association 10713667 , 12871587 , 15173315 , 27432908 , 27880917 , 7644510 , (Europe PMC )0.40, 0.57 BioGRID, IntAct, MINT YWHAG Affinity Capture-MS, anti tag coimmunoprecipitation, coimmunoprecipitation association, physical 16672277 , 26496610 , 27432908 , (Europe PMC )0.53 BioGRID, IntAct, MINT YWHAH Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, coimmunoprecipitation, two hybrid association, physical, physical association 10713667 , 16672277 , 26496610 , 27432908 , (Europe PMC )0.72 BioGRID, IntAct, MINT YWHAQ Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation association, physical 10713667 , 15629715 , 26496610 , (Europe PMC )0.35 BioGRID, IntAct YWHAZ Affinity Capture-MS, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, coimmunoprecipitation, pull down, two hybrid association, direct interaction, physical, physical association 10713667 , 12764136 , 12766774 , 15629715 , 16672277 , 26496610 , 27432908 , 28514442 , (Europe PMC )0.89 BioGRID, IntAct, MINT ZBTB21 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct ZNF638 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source YWHAB Affinity Capture-MS, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, coimmunoprecipitation, two hybrid association, physical, physical association 10713667 , 12871587 , 15173315 , 16672277 , 26496610 , 27432908 , 7644510 , (Europe PMC )0.35, 0.40, 0.86 BioGRID, IntAct, MINT YWHAE Affinity Capture-MS, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, two hybrid physical, physical association 10713667 , 12871587 , 15173315 , 27432908 , 27880917 , 7644510 , (Europe PMC )0.40, 0.57 BioGRID, IntAct, MINT YWHAG Affinity Capture-MS, anti tag coimmunoprecipitation, coimmunoprecipitation association, physical 16672277 , 26496610 , 27432908 , (Europe PMC )0.53 BioGRID, IntAct, MINT YWHAH Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, coimmunoprecipitation, two hybrid association, physical, physical association 10713667 , 16672277 , 26496610 , 27432908 , (Europe PMC )0.72 BioGRID, IntAct, MINT YWHAZ Affinity Capture-MS, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, coimmunoprecipitation, pull down, two hybrid association, direct interaction, physical, physical association 10713667 , 12764136 , 12766774 , 15629715 , 16672277 , 26496610 , 27432908 , 28514442 , (Europe PMC )0.89 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AFDN Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID AGAP1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct ANKRD34A Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct AR Reconstituted Complex physical 12569365 , (Europe PMC )NA BioGRID BRSK2 Biochemical Activity physical 15150265 , (Europe PMC )NA BioGRID BTRC Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Proximity Label-MS, Reconstituted Complex physical 15845771 , 21807946 , 25332235 , 25900982 , 26091241 , 26496610 , 27880917 , 28514442 , (Europe PMC )NA BioGRID CALU Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID CAMSAP2 Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID CBY1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct CCDC28A Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID CCNB1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID CDC14A Affinity Capture-Western, Biochemical Activity physical 20956543 , (Europe PMC )NA BioGRID CDC20 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID CDC25B Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID CDC5L Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CDK1 Affinity Capture-Western physical 11516829 , (Europe PMC )NA BioGRID CDK16 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct CDK2 Biochemical Activity, Two-hybrid, two hybrid physical, physical association 16191191 , 7644510 , 9840943 , (Europe PMC )0.37 BioGRID, IntAct CDK3 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID CDK5 Affinity Capture-Western, Biochemical Activity physical 11516829 , 22899714 , (Europe PMC )NA BioGRID CENPB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CGN Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct CHEK1 Biochemical Activity, Reconstituted Complex physical 9278511 , (Europe PMC )NA BioGRID CSNK2A1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 12527891 , (Europe PMC )NA BioGRID CUL1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID DCLK1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct DENND1A Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID DENND4C Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct DEPDC1B Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct DOCK2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EDC3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct EIF4B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct EIF4E2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct ESR1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 11689696 , (Europe PMC )NA BioGRID FAM110A Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct FAM110B Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct FAM53C Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID FBXW11 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, anti tag coimmunoprecipitation association, physical, physical association 19615732 , 21807946 , 22017875 , 25332235 , 25515538 , 25900982 , 26496610 , 27432908 , 27880917 , 28514442 , 29150431 , (Europe PMC )0.35, 0.40 BioGRID, IntAct FOXM1 Affinity Capture-Western physical 15024056 , (Europe PMC )NA BioGRID GAB2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct GIGYF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct HDAC4 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct KAT2B Reconstituted Complex physical 11689696 , (Europe PMC )NA BioGRID KCTD3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct KIF13B Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct KIF1C Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct KRT31 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct KRT35 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct KRT85 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct KSR1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct LIMA1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct LRFN1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct MAGI1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct MAP3K21 Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID MAPK14 Biochemical Activity, Reconstituted Complex physical 11333986 , (Europe PMC )NA BioGRID MAPK1IP1L Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID MAPK9 Biochemical Activity physical 15629715 , (Europe PMC )NA BioGRID MAPKAP1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct MAPKAPK2 Biochemical Activity physical 15629715 , (Europe PMC )NA BioGRID MAST3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct MELK Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, inference by socio-affinity scoring physical, physical association 12400006 , 27173435 , (Europe PMC )0.27 BioGRID, IntAct NADK Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct NAV1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct NF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PGR Reconstituted Complex physical 11689696 , (Europe PMC )NA BioGRID PHB2 Affinity Capture-MS physical 17353931 , (Europe PMC )NA BioGRID PHB2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PHLDB2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PLEKHA5 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PLEKHA7 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PPM1F Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PPM1H Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PRMT1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID PSME3 Affinity Capture-MS, two hybrid array, two hybrid prey pooling approach physical, physical association 27432908 , (Europe PMC )0.49 BioGRID, IntAct RAB3IP Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID RASAL2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct RCN1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID RTKN Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID SFN anti tag coimmunoprecipitation, coimmunoprecipitation association, physical association 15173315 , 16672277 , (Europe PMC )0.40, 0.56 IntAct, MINT SH3BP4 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct SH3PXD2A Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct SIPA1L1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct SKP1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID SRGAP2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct SRSF12 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct STK39 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID SYDE1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct TBC1D25 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct TESK2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct TIAM1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct USP21 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct WDR6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct XPO1 Affinity Capture-MS physical 26673895 , (Europe PMC )NA BioGRID YWHAB Affinity Capture-MS, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, coimmunoprecipitation, two hybrid association, physical, physical association 10713667 , 12871587 , 15173315 , 16672277 , 26496610 , 27432908 , 7644510 , (Europe PMC )0.35, 0.40, 0.86 BioGRID, IntAct, MINT YWHAE Affinity Capture-MS, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, two hybrid physical, physical association 10713667 , 12871587 , 15173315 , 27432908 , 27880917 , 7644510 , (Europe PMC )0.40, 0.57 BioGRID, IntAct, MINT YWHAG Affinity Capture-MS, anti tag coimmunoprecipitation, coimmunoprecipitation association, physical 16672277 , 26496610 , 27432908 , (Europe PMC )0.53 BioGRID, IntAct, MINT YWHAH Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, coimmunoprecipitation, two hybrid association, physical, physical association 10713667 , 16672277 , 26496610 , 27432908 , (Europe PMC )0.72 BioGRID, IntAct, MINT YWHAQ Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation association, physical 10713667 , 15629715 , 26496610 , (Europe PMC )0.35 BioGRID, IntAct YWHAZ Affinity Capture-MS, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, coimmunoprecipitation, pull down, two hybrid association, direct interaction, physical, physical association 10713667 , 12764136 , 12766774 , 15629715 , 16672277 , 26496610 , 27432908 , 28514442 , (Europe PMC )0.89 BioGRID, IntAct, MINT ZBTB21 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct ZNF638 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
AURKA S312_EEKDLVMsSKCQRLF , S339_ILKRLERsQDRDTPV , S353_VQNKRRRsVTPPEEQ , in vitro, in vivo 15128871 ,(Europe PMC )HPRD, PhosphoSitePlus , Aurora A S353_VQNKRRRsVTPPEEQ , LTP 15128871 ,(Europe PMC )PhosphoELM , BRSK1 S375_ARVLRSKsLCHDEIE , LTP 15150265 ,(Europe PMC )PhosphoELM , PhosphoSitePlus , CDK1 S146_IRNEQFAsRRFQSMP , S146_PVRLLGHsPVLRNIT , S160_PVRLLGHsPVLRNIT , S307_KCQRLFRsPSMPCSV , S321_KCQRLFRsPSMPCSV , LTP, in vitro 12107172 ,(Europe PMC )HPRD, PhosphoELM , PhosphoSitePlus , CHEK1 S230_AFAQRPSsAPDLMCL , S563_TFRLKTRsWAGERSR , NA NA PhosphoSitePlus , CHK1 S230_AFAQRPSsAPDLMCL , LTP 17003105 ,(Europe PMC )PhosphoELM , CK2_alpha S186_EAGSGAAsSSGEDKE , S187_AGSGAASsSGEDKEN , LTP 12527891 ,(Europe PMC )PhosphoELM , CK2_group S186_EAGSGAAsSSGEDKE , S187_AGSGAASsSGEDKEN , LTP 12527891 ,(Europe PMC )PhosphoELM , CSNK2A1 S172_NITNSQAsDGRRKSE , S173_ITNSQAPsGRRKSEA , S186_EAGSGAAsSSGEDKE , S187_AGSGAASsSGEDKEN , in vitro, in vivo 12527891 ,(Europe PMC )HPRD, PhosphoSitePlus , Eg3 kinase S169_VLRNITNsQAPDGRR , S323_QRLFRSPsMPCSVIR , LTP 12400006 , 15908796 ,(Europe PMC )PhosphoELM , MAPK11 S249_KMEVEELsPLALGRF , NA NA PhosphoSitePlus , MAPKAPK2 S169_VLRNITNsQAPDGRR , S323_QRLFRSPsMPCSVIR , S353_VQNKRRRsVTPPEEQ , S375_ARVLRSKsLCHDEIE , LTP 15629715 ,(Europe PMC )PhosphoELM , PhosphoSitePlus , MELK S169_VLRNITNsQAPDGRR , S280_DILESDLsDDDAVPP , S307_TLEKEEEsDLVMYSK , S321_KCQRLFRsPSMPCSV , S323_QRLFRSPsMPCSVIR , in vitro 12400006 ,(Europe PMC )HPRD, PhosphoSitePlus , PLK1 S209_PWKPTHPsSTHALAE , S291_AVPPGMEsLISAPLV , S353_VQNKRRRsVTPPEEQ , S375_ARVLRSKsLCHDEIE , S397_RELIGDYsKAFLLQT , S465_PLERDAEsFLLKSPI , S50_PVRAAASsPVTTLTQ , S513_RAVNDYPsLYYPEMY , T127_DPHMAEQtFEQAIQA , T167_SPVLRNItNSQAPDG , T265_LTPAEGDtEEDDGFV , T404_SKAFLLQtVDGKHQD , T58_PVTTLTQtMHDLAGL , NA NA PhosphoSitePlus , RPS6KA1 S353_VQNKRRRsVTPPEEQ , T355_NKRRRSVtPPEEQQE , NA NA PhosphoSitePlus , Unknown S249_KMEVEELsPLALGRF , S263_FSLTPAEsDTEEDDG , S334_SVIRPILsRLERPQD , S353_VQNKRRRsVTPPEEQ , S361_VTPPEEQsEAEEPKA , S375_ARVLRSKsLCHDEIE , S396_HRELIGDsSKAFLLQ , T243_CLSPDRKtEVEELSP , T314_KDLVMYStCQRLFRS , T341_KRLERPQtRDTPVQN , T355_NKRRRSVtPPEEQQE , T376_RVLRSKStCHDEIEN , HTP, LTP, in vivo 12400006 , 16861915 , 18669648 ,(Europe PMC )HPRD, PhosphoELM ,