Top
BRCA1
Localization (UniProt annotation) Nucleus Chromosome Cytoplasm Note=Localizes at sites of DNAdamage at double-strand breaks (DSBs); recruitment to DNA damagesites is mediated by ABRAXAS1 and the BRCA1-A complex(PubMed:26778126) Translocated to the cytoplasm during UV-inducedapoptosis (PubMed:20160719) Isoform 3: Cytoplasm Isoform 5: Cytoplasm Function (UniProt annotation) E3 ubiquitin-protein ligase that specifically mediatesthe formation of 'Lys-6'-linked polyubiquitin chains and plays acentral role in DNA repair by facilitating cellular responses toDNA damage It is unclear whether it also mediates the formationof other types of polyubiquitin chains The E3 ubiquitin-proteinligase activity is required for its tumor suppressor function TheBRCA1-BARD1 heterodimer coordinates a diverse range of cellularpathways such as DNA damage repair, ubiquitination andtranscriptional regulation to maintain genomic stabilityRegulates centrosomal microtubule nucleation Required for normalcell cycle progression from G2 to mitosis Required forappropriate cell cycle arrests after ionizing irradiation in boththe S-phase and the G2 phase of the cell cycle Involved intranscriptional regulation of P21 in response to DNA damageRequired for FANCD2 targeting to sites of DNA damage May functionas a transcriptional regulator Inhibits lipid synthesis bybinding to inactive phosphorylated ACACA and preventing itsdephosphorylation Contributes to homologous recombination repair(HRR) via its direct interaction with PALB2, fine-tunesrecombinational repair partly through its modulatory role in thePALB2-dependent loading of BRCA2-RAD51 repair machinery at DNAbreaks Component of the BRCA1-RBBP8 complex which regulates CHEK1activation and controls cell cycle G2/M checkpoints on DNA damagevia BRCA1-mediated ubiquitination of RBBP8 Acts as atranscriptional activator (PubMed:20160719) Catalytic Activity (UniProt annotation) S-ubiquitinyl-[E2 ubiquitin-conjugatingenzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptorprotein]-L-lysine Protein Sequence MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQESTRFS
QLVEELLKIICAFQLDTGLEYANSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSLQETSLSVQLSNLG
TVRTLRTKQRIQPQKTSVYIELGSDSSEDTVNKATYCSVGDQELLQITPQGTRDEISLDSAKKAACEFSETDVTNTEHHQ
PSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGTNTHASSLQHENSSLLLTKDRMNVEKAEFCNKSKQPGLARSQHNR
WAGSKETCNDRRTPSTEKKVDLNADPLCERKEWNKQKLPCSENPRDTEDVPWITLNSSIQKVNEWFSRSDELLGSDDSHD
GESESNAKVADVLDVLNEVDEYSGSSEKIDLLASDPHEALICKSERVHSKSVESNIEDKIFGKTYRKKASLPNLSHVTEN
LIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADLAVQKTPEMINQGTNQTEQNGQVMNITNSGHENKTKGD
SIQNEKNPNPIESLEKESAFKTKAEPISSSISNMELELNIHNSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQ
IDSCSSSEEIKKKKYNQMPVRHSRNLQLMEGKEPATGAKKSNKPNEQTSKRHDSDTFPELKLTNAPGSFTKCSNTSELKE
FVNPSLPREEKEEKLETVKVSNNAEDPKDLMLSGERVLQTERSVESSSISLVPGTDYGTQESISLLEVSTLGKAKTEPNK
CVSQCAAFENPKGLIHGCSKDNRNDTEGFKYPLGHEVNHSRETSIEMEESELDAQYLQNTFKVSKRQSFAPFSNPGNAEE
ECATFSAHSGSLKKQSPKVTFECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKDKPVDNAKCSIKGGSRFCLSSQFRG
NETGLITPNKHGLLQNPYRIPPLFPIKSFVKTKCKKNLLEENFEEHSMSPEREMGNENIPSTVSTISRNNIRENVFKEAS
SSNINEVGSSTNEVGSSINEIGSSDENIQAELGRNRGPKLNAMLRLGVLQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTV
NTDFSPYLISDNLEQPMGSSHASQVCSETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQKGELSRSPSPFTHTHLAQ
GYRRGAKKLESSEENLSSEDEELPCFQHLLFGKVNNIPSQSTRHSTVATECLSKNTEENLLSLKNSLNDCSNQVILAKAS
QEHHLSEETKCSASLFSSQCSELEDLTANTNTQDPFLIGSSKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQS
MDSNLGEAASGCESETSVSEDCSGLSSQSDILTTQQRDTMQHNLIKLQQEMAELEAVLEQHGSQPSNSYPSIISDSSALE
DLRNPEQSTSEKAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVERSSPSKCPSLDDRWYMHSCSGSLQNR
NYPSQEELIKVVDVEEQQLEESGPHDLTETSYLPRQDLEGTPYLESGISLFSDDPESDPSEDRAPESARVGNIPSSTSAL
KVPQLKVAESAQSPAAAHTTDTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFMLVYKFARKHHITLTNLI
TEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKI
FRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLD
SVALYQCQELDTYLIPQIPHSHY
BRCA1 is dephosphorylated by following phosphatases:
Pathway ID Pathway Name Pathway Description (KEGG) hsa01524 Platinum drug resistance Platinum-based drugs cisplatin, carboplatin and oxaliplatin are widely used in the therapy of solid malignancies, including testicular, ovarian, head and neck, colorectal, bladder and lung cancers. The mechanism of action of Platinum-based drugs involves covalent binding to purine DNA bases, which primarily leads to cellular apoptosis. Their clinical success is, however, limited due to severe side effects and intrinsic or acquired resistance to the treatment. Platinum resistance could arise from decreased drug influx, increased drug efflux, intracellular detoxification by glutathione, etc., decreased binding (e.g., due to high intracellular pH), increased DNA repair, decreased mismatch repair, defective apoptosis, and altered oncogene expression. hsa03440 Homologous recombination Homologous recombination (HR) is essential for the accurate repair of DNA double-strand breaks (DSBs), potentially lethal lesions. HR takes place in the late S-G2 phase of the cell cycle and involves the generation of a single-stranded region of DNA, followed by strand invasion, formation of a Holliday junction, DNA synthesis using the intact strand as a template, branch migration and resolution. It is investigated that RecA/Rad51 family proteins play a central role. The breast cancer susceptibility protein Brca2 and the RecQ helicase BLM (Bloom syndrome mutated) are tumor suppressors that maintain genome integrity, at least in part, through HR. hsa03460 Fanconi anemia pathway The Fanconi anemia pathway is required for the efficient repair of damaged DNA, especially interstrand cross-links (ICLs). DNA ICL is directly recognized by FANCM and associated proteins, that recruit the FA core complex. The FA core complex monoubiquitinates FANCD2 and FANCI. The monoubiquitinated FANCD2/FANCI becomes an active form and interacts with a series of DNA repair proteins and facilitates downstream repair pathways. Fanconi anemia is caused by mutations in one of at least 13 FA genes and is characterized by congenital growth abnormalities, bone marrow failure and cancer predisposition. hsa04120 Ubiquitin mediated proteolysis Protein ubiquitination plays an important role in eukaryotic cellular processes. It mainly functions as a signal for 26S proteasome dependent protein degradation. The addition of ubiquitin to proteins being degraded is performed by a reaction cascade consisting of three enzymes, named E1 (ubiquitin activating enzyme), E2 (ubiquitin conjugating enzyme), and E3 (ubiquitin ligase). Each E3 has specificity to its substrate, or proteins to be targeted by ubiquitination. Many E3s are discovered in eukaryotes and they are classified into four types: HECT type, U-box type, single RING-finger type, and multi-subunit RING-finger type. Multi-subunit RING-finger E3s are exemplified by cullin-Rbx E3s and APC/C. They consist of a RING-finger-containing subunit (RBX1 or RBX2) that functions to bind E2s, a scaffold-like cullin molecule, adaptor proteins, and a target recognizing subunit that binds substrates. hsa04151 PI3K-Akt signaling pathway The phosphatidylinositol 3' -kinase(PI3K)-Akt signaling pathway is activated by many types of cellular stimuli or toxic insults and regulates fundamental cellular functions such as transcription, translation, proliferation, growth, and survival. The binding of growth factors to their receptor tyrosine kinase (RTK) or G protein-coupled receptors (GPCR) stimulates class Ia and Ib PI3K isoforms, respectively. PI3K catalyzes the production of phosphatidylinositol-3,4,5-triphosphate (PIP3) at the cell membrane. PIP3 in turn serves as a second messenger that helps to activate Akt. Once active, Akt can control key cellular processes by phosphorylating substrates involved in apoptosis, protein synthesis, metabolism, and cell cycle. hsa05206 MicroRNAs in cancer MicroRNA (miRNA) is a cluster of small non-encoding RNA molecules of 21 - 23 nucleotides in length, which controls gene expression post-transcriptionally either via the degradation of target mRNAs or the inhibition of protein translation. Using high-throughput profiling, dysregulation of miRNAs has been widely observed in different stages of cancer. The upregulation (overexpression) of specific miRNAs could lead to the repression of tumor suppressor gene expression, and conversely the downregulation of specific miRNAs could result in an increase of oncogene expression; both these situations induce subsequent malignant effects on cell proliferation, differentiation, and apoptosis that lead to tumor growth and progress. The miRNA signatures of cancer observed in various studies differ significantly. These inconsistencies occur due to the differences in the study populations and methodologies used. This pathway map shows the summarized results from various studies in 9 cancers, each of which is presented in a review article. hsa05224 Breast cancer Breast cancer is the leading cause of cancer death among women worldwide. The vast majority of breast cancers are carcinomas that originate from cells lining the milk-forming ducts of the mammary gland. The molecular subtypes of breast cancer, which are based on the presence or absence of hormone receptors (estrogen and progesterone subtypes) and human epidermal growth factor receptor-2 (HER2), include: hormone receptor positive and HER2 negative (luminal A subtype), hormone receptor positive and HER2 positive (luminal B subtype), hormone receptor negative and HER2 positive (HER2 positive), and hormone receptor negative and HER2 negative (basal-like or triple-negative breast cancers (TNBCs)). Hormone receptor positive breast cancers are largely driven by the estrogen/ER pathway. In HER2 positive breast tumours, HER2 activates the PI3K/AKT and the RAS/RAF/MAPK pathways, and stimulate cell growth, survival and differentiation. In patients suffering from TNBC, the deregulation of various signalling pathways (Notch and Wnt/beta-catenin), EGFR protein have been confirmed. In the case of breast cancer only 8% of all cancers are hereditary, a phenomenon linked to genetic changes in BRCA1 or BRCA2. Somatic mutations in only three genes (TP53, PIK3CA and GATA3) occurred at >10% incidence across all breast cancers.
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-1221632 Meiotic synapsis. Meiotic synapsis is the stable physical pairing of homologous chromosomes that begins in leptonema of prophase I and lasts until anaphase of prophase I. First, short segments of axial elements form along chromosomes. Telomeres then cluster at a region of the inner nuclear membrane and axial elements extend and fuse along the length of the chromosomes. Subsequent to the initiation of recombination transverse filaments of SYCP1 link axial/lateral elements to a central element containing SYCE1 and SYCE2, thus forming the synaptonemal complex (reviewed in Yang and Wang 2009).Unsynapsed regions are silenced during pachynema by recruitment of BRCA1 and ATR, which phosphorylates histone H2AX (reviewed in Inagaki et al. 2010) R-HSA-3108214 SUMOylation of DNA damage response and repair proteins. Several factors that participate in DNA damage response and repair are SUMOylated (reviewed in Dou et al. 2011, Bekker-Jensen and Mailand 2011, Ulrich 2012, Psakhye and Jentsch 2012, Bologna and Ferrari 2013, Flotho and Melchior 2013, Jackson and Durocher 2013). SUMOylation can alter enzymatic activity and protein stability or it can serve to recruit additional factors. For example, SUMOylation of Thymine DNA glycosylase (TDG) causes TDG to lose affinity for its product, an abasic site opposite a G residue, and thus increases turnover of the enzyme. During repair of double-strand breaks SUMO1, SUMO2, SUMO3, and the SUMO E3 ligases PIAS1 and PIAS4 accumulate at double-strand breaks where BRCA1, HERC1, RNF168, MDC1, and TP53BP1 are SUMOylated. SUMOylation of BRCA1 may increase its ubiquitin ligase activity while SUMOylation of MDC1 and HERC2 appears to play a role in recruitment of proteins such as RNF4 and RNF8 to double strand breaks. Similarly SUMOylation of RPA1 (RPA70) recruits RAD51 in the homologous recombination pathway R-HSA-5685938 HDR through Single Strand Annealing (SSA). Homology directed repair (HDR) through single strand annealing (SSA), similar to HDR through homologous recombination repair (HRR), involves extensive resection of DNA double strand break ends (DSBs), preceded by ATM activation and formation of the so-called ionizing radiation induced foci (IRIF) at DNA DSB sites. Following ATM activation and foci formation, the two-step resection is initiated by the MRN complex (MRE11A:RAD50:NBN) and RBBP8 (CtIP) associated with BRCA1:BARD1, and completed by EXO1 or DNA2 in cooperation with DNA helicases BLM, WRN and BRIP1 (BACH1) (Sartori et al. 2007, Yun and Hiom 2009, Eid et al. 2010, Nimonkar et al. 2011, Suhasini et al. 2011, Sturzenegger et al. 2014). Long 3'-ssDNA overhangs produced by extensive resection are coated by the RPA heterotrimer (RPA1:RPA2:RPA3), triggering ATR signaling. ATR signaling is needed for SSA, probably because of the related phosphorylation of RPA2 (Zou and Elledge 2003, Anantha et al. 2007, Liu et al. 2012).RAD52 is the key mediator of SSA. Activated ATM phosphorylates and activates ABL1, and activated ABL1 subsequently phosphorylates pre-formed RAD52 heptameric rings, increasing their affinity for ssDNA (Honda et al. 2011). Phosphorylated RAD52 binds phosphorylated RPA heterotrimers on 3'-ssDNA overhangs at resected DNA DSBs. RAD52 also binds RAD51 and prevents formation of invasive RAD51 nucleofilaments involved in HRR (Chen et al. 1999, Van Dyck et al. 1999, Parsons et al. 2000, Jackson et al. 2002, Singleton et al. 2002).
RAD52 promotes annealing of two 3'-ssDNA overhangs when highly homologous directed repeats are present in both 3'-ssDNA overhangs. Nonhomologous regions lying 3' to the annealed repeats are displaced as 3'-flaps (Parsons et al. 2000, Van Dyck et al. 2001, Singleton et al. 2002, Stark et al. 2004, Mansour et al. 2008). The endonuclease complex composed of ERCC1 and ERCC4 (XPF) is subsequently recruited to SSA sites through direct interaction between RAD52 and ERCC4, leading to cleavage of 3' flaps (Motycka et al. 2004, Al-Minawi et al. 2008). The identity of a DNA ligase that closes the remaining single strand nicks (SSBs) to complete SSA-mediated repair is not known.
SSA results in deletion of one of the annealed repeats and the intervening DNA sequence between the two annealed repeats and is thus mutagenic
R-HSA-5685942 HDR through Homologous Recombination (HRR). Homology directed repair (HDR) through homologous recombination is known as homologous recombination repair (HRR). HRR occurs after extensive resection of DNA double strand break (DSB) ends, which creates long 3'-ssDNA overhangs. RAD51 coats 3'-ssDNA overhangs in a BRCA2-controlled fashion, creating invasive RAD51 nucleofilaments. The RAD51 nucleofilament invades a sister chromatid DNA duplex, leading to D-loop formation. After the D-loop is extended by DNA repair synthesis, the resulting recombination intermediates in the form of extended D-loops or double Holliday junctions can be resolved through crossover- or non-crossover-generating processes (reviewed by Ciccia and Elledge 2010) R-HSA-5689901 Metalloprotease DUBs. The JAB1/MPN +/MOV34 (JAMM) domain metalloproteases cleave the isopeptide bond at or near the the attachment point of polyubiquitin and substrate. PSMD14 (RPN11), STAMBP (AMSH), STAMBPL1 (AMSH-LP), and BRCC3 (BRCC36) are highly specific for the K63 poly-Ub linkage, which may be a general characteristic (Eletr & Wilkinson 2014). Two multisubunit complexes represented elsewhere in Reactome contain JAMM DUBs. The proteasome 19S lid complex includes PSMD14, an endopeptidase that cleaves poly-Ub chains from substrates as they are degraded by the proteasome (Verma et al. 2002). The COP9-Signalosome contains COPS5 (CSN5), which deconjugates the Ub-like modifier Nedd8, modulating the activity of the SCF E3 ligase (Cope et al. 2002). JAMM DUB catalysis requires nucleophilic attack on the carbonyl carbon of the isopeptide bond by an activated water molecule bound to Zn2+ and a conserved glutamate. A negatively-charged tetrahedral transition state ensues, and a nearby conserved Ser/Thr in the JAMM domains stabilizes the oxyanion. The tetrahedral intermediate then collapses and the Glu serves as a general base donating a proton to the leaving Lys side chain (Ambroggio et al. 2004) R-HSA-5693554 Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA). In the synthesis-dependent strand-annealing (SDSA) model of D-loop resolution, D-loop strands extended by DNA repair synthesis dissociate from their sister chromatid complements and reanneal with their original complementary strands, resulting in non-crossover products (Mitchel et al. 2010). SDSA is promoted by the DNA helicase RTEL1 (Barber et al. 2008, Uringa et al. 2012). Additional DNA synthesis occurs to fill the remaining single strand gap present in the reannealed DNA duplex. DNA polymerase alpha has been implicated in this late step of DNA repair synthesis (Levy et al. 2009), although RTEL1-mediated recruitment of PCNA-bound DNA polymerases may also be involved (Vannier et al. 2013). The remaining single strand nicks are closed by DNA ligases, possibly LIG1 or LIG3 (Mortusewicz et al. 2006, Puebla-Osorio et al. 2006) R-HSA-5693565 Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks. Activated ATM phosphorylates a number of proteins involved in the DNA damage checkpoint and DNA repair (Thompson and Schild 2002, Ciccia and Elledge 2010), thereby triggering and coordinating accumulation of DNA DSB repair proteins in nuclear foci known as ionizing radiation-induced foci (IRIF). While IRIFs include chromatin regions kilobases away from the actual DSB site, this Reactome pathway represents simplified foci and events that happen proximal to the DNA DSB ends. In general, proteins localizing to the nuclear foci in response to ATM signaling are cooperatively retained at the DNA DSB site, forming a positive feedback loop and amplifying DNA damage response (Soutoglou and Misteli 2008).Activated ATM phosphorylates the NBN (NBS1) subunit of the MRN complex (MRE11A:RAD50:NBN) (Gatei et al. 2000), as well as the nucleosome histone H2AFX (H2AX) on serine residue S139, producing gamma-H2AFX (gamma-H2AX) containing nucleosomes (Rogakou et al. 1998, Burma et al. 2001). H2AFX is phosphorylated on tyrosine 142 (Y142) under basal conditions (Xiao et al. 2009). After ATM-mediated phosphorylation of H2AFX on S139, tyrosine Y142 has to be dephosphorylated by EYA family phosphatases in order for the DNA repair to proceed and to avoid apoptosis induced by DNA DSBs (Cook et al. 2009). Gamma-H2AFX recruits MDC1 to DNA DSBs (Stucki et al. 2005). After ATM phosphorylates MDC1 (Liu et al. 2012), the MRN complex, gamma-H2AFX nucleosomes, and MDC1 serve as a core of the nuclear focus and a platform for the recruitment of other proteins involved in DNA damage signaling and repair (Lukas et al. 2004, Soutoglou and Misteli 2008).
RNF8 ubiquitin ligase binds phosphorylated MDC1 (Kolas et al. 2007) and, in cooperation with HERC2 and RNF168 (Bekker-Jensen et al. 2010, Campbell et al. 2012), ubiquitinates H2AFX (Mailand et al. 2007, Huen et al. 2007, Stewart et al. 2009, Doil et al. 2009) and histone demethylases KDM4A and KDM4B (Mallette et al. 2012).
Ubiquitinated gamma-H2AFX recruits UIMC1 (RAP80), promoting the assembly of the BRCA1-A complex at DNA DSBs. The BRCA1-A complex consists of RAP80, FAM175A (Abraxas), BRCA1:BARD1 heterodimer, BRCC3 (BRCC36), BRE (BRCC45) and BABAM1 (MERIT40, NBA1) (Wang et al. 2007, Wang and Elledge 2007)
Ubiquitin mediated degradation of KDM4A and KDM4B allows TP53BP1 (53BP1) to associate with histone H4 dimethylated on lysine K21 (H4K20Me2 mark) by WHSC1 at DNA DSB sites (Pei et al. 2011).
Once recruited to DNA DSBs, both BRCA1:BARD1 heterodimers and TP53BP1 are phosphorylated by ATM (Cortez et al. 1999, Gatei et al. 2000, Kim et al. 2006, Jowsey et al. 2007), which triggers recruitment and activation of CHEK2 (Chk2, Cds1) (Wang et al. 2002, Wilson and Stern 2008, Melchionna et al. 2000).
Depending on the cell cycle stage, BRCA1 and TP53BP1 competitively promote either homology directed repair (HDR) or nonhomologous end joining (NHEJ) of DNA DSBs. HDR through homologous recombination repair (HRR) or single strand annealing (SSA) is promoted by BRCA1 in association with RBBP8 (CtIP), while NHEJ is promoted by TP53BP1 in association with RIF1 (Escribano-Diaz et al. 2013)
R-HSA-5693568 Resolution of D-loop Structures through Holliday Junction Intermediates. D-loops generated after strand invasion and DNA repair synthesis during homologous recombination repair (HRR) can be resolved through Holliday junction intermediates.A D-loop can be cleaved by the complex of MUS81 and EME1 (MUS81:EME1) or MUS81 and EME2 (MUS81:EME2) and resolved without the formation of double Holliday junctions, generating cross-over products. All steps involved in this process have not been elucidated (Osman et al. 2003, Schwartz et al. 2012, Pepe and West 2014).
Alternatively, double Holliday junctions can be created by ligation of crossed-strand intermediates. Double Holliday junctions can then be resolved through the action of the BLM helicase complex known as BTRR (BLM:TOP3A:RMI1:RMI2) (Wan et al. 2013, Bocquet et al. 2014). BLM-mediated resolution of Holliday junction intermediates prevents sister chromatid exchange (SCE) between mitotic chromosomes and generates non-crossover products. Mitotic SCE can result in the loss-of-heterozygosity (LOH), which can make the cell homozygous for deleterious recessive mutations (e.g. in tumor suppressor genes) (Wu and Hickson 2003). Double Holliday junctions can also be resolved by cleavage, mediated by GEN1 or the SLX-MUS complex (composed of SLX1A:SLX4 heterodimer and a heterodimer of MUS81 and EME1 or, possibly, EME2). The resolvase activity of GEN1 and SLX-MUS predominantly results in crossover products, with SCE (Fekairi et al. 2009, Wyatt et al. 2013, Sarbajna et al. 2014)
R-HSA-5693571 Nonhomologous End-Joining (NHEJ). The nonhomologous end joining (NHEJ) pathway is initiated in response to the formation of DNA double-strand breaks (DSBs) induced by DNA-damaging agents, such as ionizing radiation. DNA DSBs are recognized by the MRN complex (MRE11A:RAD50:NBN), leading to ATM activation and ATM-dependent recruitment of a number of DNA damage checkpoint and repair proteins to DNA DSB sites (Lee and Paull 2005). The ATM phosphorylated MRN complex, MDC1 and H2AFX-containing nucleosomes (gamma-H2AX) serve as scaffolds for the formation of nuclear foci known as ionizing radiation induced foci (IRIF) (Gatei et al. 2000, Paull et al. 2000, Stewart et al. 2003, Stucki et al. 2005). Ultimately, both BRCA1:BARD1 heterodimers and TP53BP1 (53BP1) are recruited to IRIF (Wang et al. 2007, Pei et al. 2011, Mallette et al. 2012), which is necessary for ATM-mediated CHEK2 activation (Wang et al. 2002, Wilson et al. 2008). In G1 cells, TP53BP1 promotes NHEJ by recruiting RIF1 and PAX1IP, which displaces BRCA1:BARD1 and associated proteins from the DNA DSB site and prevents resection of DNA DSBs needed for homologous recombination repair (HRR) (Escribano-Diaz et al. 2013, Zimmermann et al. 2013, Callen et al. 2013). TP53BP1 also plays an important role in ATM-mediated phosphorylation of DCLRE1C (ARTEMIS) (Riballo et al. 2004, Wang et al. 2014). Ku70:Ku80 heterodimer (also known as the Ku complex or XRCC5:XRCC6) binds DNA DSB ends, competing away the MRN complex and preventing MRN-mediated resection of DNA DSB ends (Walker et al. 2001, Sun et al. 2012). The catalytic subunit of the DNA-dependent protein kinase (DNA-PKcs, PRKDC) is then recruited to DNA-bound Ku to form the DNA-PK holoenzyme. Two DNA-PK complexes, one at each side of the break, bring DNA DSB ends together, joining them in a synaptic complex (Gottlieb 1993, Yoo and Dynan 2000). DNA-PK complex recruits DCLRE1C (ARTEMIS) to DNA DSB ends (Ma et al. 2002). PRKDC-mediated phosphorylation of DCLRE1C, as well as PRKDC autophosphorylation, enables DCLRE1C to trim 3'- and 5'-overhangs at DNA DSBs, preparing them for ligation (Ma et al. 2002, Ma et al. 2005, Niewolik et al. 2006). The binding of inositol phosphate may additionally stimulate the catalytic activity of PRKDC (Hanakahi et al. 2000). Other factors, such as polynucleotide kinase (PNK), TDP1 or TDP2 may remove unligatable damaged nucleotides from 5'- and 3'-ends of the DSB, converting them to ligatable substrates (Inamdar et al. 2002, Gomez-Herreros et al. 2013). DNA ligase 4 (LIG4) in complex with XRCC4 (XRCC4:LIG4) is recruited to ligatable DNA DSB ends together with the XLF (NHEJ1) homodimer and DNA polymerases mu (POLM) and/or lambda (POLL) (McElhinny et al. 2000, Hsu et al. 2002, Malu et al. 2002, Ahnesorg et al. 2006, Mahajan et al. 2002, Lee et al. 2004, Fan and Wu 2004). After POLL and/or POLM fill 1- or 2-nucleotide long single strand gaps at aligned DNA DSB ends, XRCC4:LIG4 performs the ligation of broken DNA strands, thus completing NHEJ. The presence of NHEJ1 homodimer facilitates the ligation step, especially at mismatched DSB ends (Tsai et al. 2007). Depending on other types of DNA damage present at DNA DSBs, NHEJ can result in error-free products, produce dsDNA with microdeletions and/or mismatched bases, or result in translocations (reviewed by Povrik et al. 2012) R-HSA-5693579 Homologous DNA Pairing and Strand Exchange. The presynaptic phase of homologous DNA pairing and strand exchange begins with the displacement of RPA from 3'-ssDNA overhangs created by extensive resection of DNA double strand break (DSB) ends. RPA is displaced by the joint action of RAD51 and BRCA2. BRCA2 nucleates RAD51 on 3'-ssDNA overhangs, leading to formation of invasive RAD51 nucleofilaments which are stabilized by the BCDX2 complex (RAD51B:RAD51C:RAD51D:XRCC2). Stable synaptic pairing between recombining DNA molecules involves the invasion of the homologous sister chromatid duplex DNA by the RAD51 nucleofilament and base-pairing between the invading ssDNA and the complementary sister chromatid DNA strand, while the non-complementary strand of the sister chromatid DNA duplex is displaced. This results in the formation of a D-loop structure (Sung et al., 2003). PALB2 and RAD51AP1 synergistically stimulate RAD51 recombinase activity and D-loop formation. PALB2 simultaneously interacts with RAD51, BRCA2 and RAD51AP1 (Modesti et al. 2007, Wiese et al. 2007, Buisson et al. 2010, Dray et al. 2010). PALB2 also interacts with BRCA1, and this interaction fine-tunes the localization of BRCA2 and RAD51 at DNA DSBs (Zhang et al. 2009, Sy et al. 2009). The CX3 complex, composed of RAD51C and XRCC3, binds D-loop structures through interaction with PALB2 and may be involved in the resolution of Holliday junctions (Chun et al. 2013, Park et al. 2014).While RAD52 promotes formation of invasive RAD51 nucleofilaments in yeast, human BRCA2 performs this function, while human RAD52 regulates single strand annealing (SSA) (reviewed by Ciccia and Elledge 2010)
R-HSA-5693607 Processing of DNA double-strand break ends. Homology directed repair (HDR) through homologous recombination (HRR) or single strand annealing (SSA) requires extensive resection of DNA double strand break (DSB) ends (Thompson and Limoli 2003, Ciccia and Elledge 2010). The resection is performed in a two-step process, where the MRN complex (MRE11A:RAD50:NBN) and RBBP8 (CtIP) bound to BRCA1 initiate the resection. This step is regulated by the complex of CDK2 and CCNA (cyclin A), ensuring the initiation of HRR during S and G2 phases of the cell cycle, when sister chromatids are available. The initial resection is also regulated by ATM-mediated phosphorylation of RBBP8 and CHEK2-mediated phosphorylation of BRCA1 (Chen et al. 2008, Yun and Hiom 2009, Buis et al. 2012, Wang et al. 2013, Davies et al. 2015, Parameswaran et al. 2015). After the initial resection, DNA nucleases EXO1 and/or DNA2 perform long-range resection, which is facilitated by DNA helicases BLM or WRN, as well as BRIP1 (BACH1) (Chen et al. 2008, Nimonkar et al. 2011, Sturzenegger et al. 2014, Suhasini et al. 2011). The resulting long 3'-ssDNA overhangs are coated by the RPA heterotrimers (RPA1:RPA2:RPA3), which recruit ATR:ATRIP complexes to DNA DSBs and, in collaboration with RAD17:RFC and RAD9:HUS1:RAD1 complexes, and TOPBP1 and RHNO1, activate ATR signaling. Activated ATR phosphorylates RPA2 and activates CHEK1 (Cotta-Ramusino et al. 2011), both of which are necessary prerequisites for the subsequent steps in HRR and SSA R-HSA-5693616 Presynaptic phase of homologous DNA pairing and strand exchange. The presynaptic phase of homologous DNA pairing and strand exchange during homologous recombination repair (HRR) begins with the displacement of RPA from ssDNA (Thompson and Limoli 2003) by the joint action of RAD51 and BRCA2. CHEK1-mediated phosphorylation of RAD51 and BRCA2 (Sorensen et al. 2005, Bahassi et al. 2008) is needed for BRCA2-mediated nucleation of RAD51 on 3'-ssDNA overhangs, RPA displacement and formation of RAD51 nucleofilaments (Yang et al. 2005, Jensen et al. 2010, Liu et al. 2010, Thorslund et al. 2010). Invasive RAD51 nucleofilaments are stabilized by the BCDX2 complex composed of RAD51B, RAD51C, RAD51D and XRCC2 (Masson et al. 2001, Chun et al. 2013, Amunugama et al. 2013) R-HSA-6796648 TP53 Regulates Transcription of DNA Repair Genes. Several DNA repair genes contain p53 response elements and their transcription is positively regulated by TP53 (p53). TP53-mediated regulation probably ensures increased protein level of DNA repair genes under genotoxic stress.TP53 directly stimulates transcription of several genes involved in DNA mismatch repair, including MSH2 (Scherer et al. 2000, Warnick et al. 2001), PMS2 and MLH1 (Chen and Sadowski 2005). TP53 also directly stimulates transcription of DDB2, involved in nucleotide excision repair (Tan and Chu 2002), and FANCC, involved in the Fanconi anemia pathway that repairs DNA interstrand crosslinks (Liebetrau et al. 1997). Other p53 targets that can influence DNA repair functions are RRM2B (Kuo et al. 2012), XPC (Fitch et al. 2003), GADD45A (Amundson et al. 2002), CDKN1A (Cazzalini et al. 2010) and PCNA (Xu and Morris 1999). Interestingly, the responsiveness of some of these DNA repair genes to p53 activation has been shown in human cells but not for orthologous mouse genes (Jegga et al. 2008, Tan and Chu 2002). Contrary to the positive modulation of nucleotide excision repair (NER) and mismatch repair (MMR), p53 can negatively modulate base excision repair (BER), by down-regulating the endonuclease APEX1 (APE1), acting in concert with SP1 (Poletto et al. 2016).
Expression of several DNA repair genes is under indirect TP53 control, through TP53-mediated stimulation of cyclin K (CCNK) expression (Mori et al. 2002). CCNK is the activating cyclin for CDK12 and CDK13 (Blazek et al. 2013). The complex of CCNK and CDK12 binds and phosphorylates the C-terminal domain of the RNA polymerase II subunit POLR2A, which is necessary for efficient transcription of long DNA repair genes, including BRCA1, ATR, FANCD2, FANCI, ATM, MDC1, CHEK1 and RAD51D. Genes whose transcription is regulated by the complex of CCNK and CDK12 are mainly involved in the repair of DNA double strand breaks and/or the Fanconi anemia pathway (Blazek et al. 2011, Cheng et al. 2012, Bosken et al. 2014, Bartkowiak and Greenleaf 2015, Ekumi et al. 2015)
R-HSA-6804756 Regulation of TP53 Activity through Phosphorylation. Phosphorylation of TP53 (p53) at the N-terminal serine residues S15 and S20 plays a critical role in protein stabilization as phosphorylation at these sites interferes with binding of the ubiquitin ligase MDM2 to TP53. Several different kinases can phosphorylate TP53 at S15 and S20. In response to double strand DNA breaks, S15 is phosphorylated by ATM (Banin et al. 1998, Canman et al. 1998, Khanna et al. 1998), and S20 by CHEK2 (Chehab et al. 1999, Chehab et al. 2000, Hirao et al. 2000). DNA damage or other types of genotoxic stress, such as stalled replication forks, can trigger ATR-mediated phosphorylation of TP53 at S15 (Lakin et al. 1999, Tibbetts et al. 1999) and CHEK1-mediated phosphorylation of TP53 at S20 (Shieh et al. 2000). In response to various types of cell stress, NUAK1 (Hou et al. 2011), CDK5 (Zhang et al. 2002, Lee et al. 2007, Lee et al. 2008), AMPK (Jones et al. 2005) and TP53RK (Abe et al. 2001, Facchin et al. 2003) can phosphorylate TP53 at S15, while PLK3 (Xie, Wang et al. 2001, Xie, Wu et al. 2001) can phosphorylate TP53 at S20.Phosphorylation of TP53 at serine residue S46 promotes transcription of TP53-regulated apoptotic genes rather than cell cycle arrest genes. Several kinases can phosphorylate S46 of TP53, including ATM-activated DYRK2, which, like TP53, is targeted for degradation by MDM2 (Taira et al. 2007, Taira et al. 2010). TP53 is also phosphorylated at S46 by HIPK2 in the presence of the TP53 transcriptional target TP53INP1 (D'Orazi et al. 2002, Hofmann et al. 2002, Tomasini et al. 2003). CDK5, in addition to phosphorylating TP53 at S15, also phosphorylates it at S33 and S46, which promotes neuronal cell death (Lee et al. 2007).
MAPKAPK5 (PRAK) phosphorylates TP53 at serine residue S37, promoting cell cycle arrest and cellular senescence in response to oncogenic RAS signaling (Sun et al. 2007).
NUAK1 phosphorylates TP53 at S15 and S392, and phosphorylation at S392 may contribute to TP53-mediated transcriptional activation of cell cycle arrest genes (Hou et al. 2011). S392 of TP53 is also phosphorylated by the complex of casein kinase II (CK2) bound to the FACT complex, enhancing transcriptional activity of TP53 in response to UV irradiation (Keller et al. 2001, Keller and Lu 2002).
The activity of TP53 is inhibited by phosphorylation at serine residue S315, which enhances MDM2 binding and degradation of TP53. S315 of TP53 is phosphorylated by Aurora kinase A (AURKA) (Katayama et al. 2004) and CDK2 (Luciani et al. 2000). Interaction with MDM2 and the consequent TP53 degradation is also increased by phosphorylation of TP53 threonine residue T55 by the transcription initiation factor complex TFIID (Li et al. 2004).
Aurora kinase B (AURKB) has been shown to phosphorylate TP53 at serine residue S269 and threonine residue T284, which is possibly facilitated by the binding of the NIR co-repressor. AURKB-mediated phosphorylation was reported to inhibit TP53 transcriptional activity through an unknown mechanism (Wu et al. 2011). A putative direct interaction between TP53 and AURKB has also been described and linked to TP53 phosphorylation and S183, T211 and S215 and TP53 degradation (Gully et al. 2012)
R-HSA-69473 G2/M DNA damage checkpoint. Throughout the cell cycle, the genome is constantly monitored for damage, resulting either from errors of replication, by-products of metabolism or through extrinsic sources such as ultra-violet or ionizing radiation. The different DNA damage checkpoints act to inhibit or maintain the inhibition of the relevant CDK that will control the next cell cycle transition. The G2 DNA damage checkpoint prevents mitotic entry solely through T14Y15 phosphorylation of Cdc2 (Cdk1). Failure of the G2 DNA damage checkpoint leads to catastrophic attempts to segregate unrepaired chromosomes R-HSA-8953750 Transcriptional Regulation by E2F6. E2F6, similar to other E2F proteins, possesses the DNA binding domain, the dimerization domain and the marked box. E2F6, however, does not have a pocket protein binding domain and thus does not interact with the retinoblastoma family members RB1, RBL1 (p107) and RBL2 (p130) (Gaubatz et al. 1998, Trimarchi et al. 1998, Cartwright et al. 1998). E2F6 lacks the transactivation domain and acts as a transcriptional repressor (Gaubatz et al. 1998, Trimarchi et al. 1998, Cartwright et al. 1998). E2F6 forms a heterodimer with TFDP1 (DP-1) (Trimarchi et al. 1998, Ogawa et al. 2002, Cartwright et al. 1998) or TFDP2 (DP-2) (Gaubatz et al. 1998, Trimarchi et al. 1998, Cartwright et al. 1998).E2f6 knockout mice are viable and embryonic fibroblasts derived from these mice proliferate normally. Although E2f6 knockout mice appear healthy, they are affected by homeotic transformations of the axial skeleton, involving vertebrae and ribs. Similar skeletal defects have been reported in mice harboring mutations in polycomb genes, suggesting that E2F6 may function in recruitment of polycomb repressor complex(es) to target promoters (Storre et al. 2002).
E2F6 mediates repression of E2F responsive genes. While E2F6 was suggested to maintain G0 state in quiescent cells (Gaubatz et al. 1998, Ogawa et al. 2002), this finding has been challenged (Giangrande et al. 2004, Bertoli et al. 2013, Bertoli et al. 2016). Instead, E2F6-mediated gene repression in proliferating (non-quiescent) cells is thought to repress E2F targets involved in G1/S transition during S phase of the cell cycle. E2F6 does not affect E2F targets involved in G2/M transition (Oberley et al. 2003, Giangrande et al. 2004, Attwooll et al. 2005, Trojer et al. 2011, Bertoli et al. 2013). In the context of the E2F6.com-1 complex, E2F6 was shown to bind to promoters of E2F1, MYC, CDC25A and TK1 genes (Ogawa et al. 2002). E2F6 also binds the promoters of CDC6, RRM1 (RR1), PCNA and TYMS (TS) genes (Giangrande et al. 2004), as well as the promoter of the DHFR gene (Gaubatz et al. 1998). While transcriptional repression by the E2F6.com 1 complex may be associated with histone methyltransferase activity (Ogawa et al. 2002), E2F6 can also repress transcription independently of H3K9 methylation (Oberley et al. 2003).
During S phase, E2F6 is involved in the DNA replication stress checkpoint (Bertoli et al. 2013, Bertoli et al. 2016). Under replication stress, CHEK1-mediated phosphorylation prevents association of E2F6 with its target promoters, allowing transcription of E2F target genes whose expression is needed for resolution of stalled replication forks and restart of DNA synthesis. Inability to induce transcription of E2F target genes (due to CHEK1 inhibition or E2F6 overexpression) leads to replication stress induced DNA damage (Bertoli et al. 2013, Bertoli et al. 2016). E2F6 represses transcription of a number of E2F targets involved in DNA synthesis and repair, such as RRM2, RAD51, BRCA1, and RBBP8 (Oberley et al. 2003, Bertoli et al. 2013)
R-HSA-912446 Meiotic recombination. Meiotic recombination exchanges segments of duplex DNA between chromosomal homologs, generating genetic diversity (reviewed in Handel and Schimenti 2010, Inagaki et al. 2010, Cohen et al. 2006). There are two forms of recombination: non-crossover (NCO) and crossover (CO). In mammals, the former is required for correct pairing and synapsis of homologous chromosomes, while CO intermediates called chiasmata are required for correct segregation of bivalents.Meiotic recombination is initiated by double-strand breaks created by SPO11, which remains covalently attached to the 5' ends after cleavage. SPO11 is removed by cleavage of single DNA strands adjacent to the covalent linkage. The resulting 5' ends are further resected to produce protruding 3' ends. The single-stranded 3' ends are bound by RAD51 and DMC1, homologs of RecA that catalyze a search for homology between the bound single strand and duplex DNA of the chromosomal homolog. RAD51 and DMC1 then catalyze the invasion of the single strand into the homologous duplex and the formation of a D-loop heteroduplex. Approximately 90% of heteroduplexes are resolved without crossovers (NCO), probably by synthesis-dependent strand annealing.The invasive strand is extended along the homolog and ligated back to its original duplex, creating a double Holliday junction. The mismatch repair proteins MSH4, MSH5 participate in this process, possibly by stabilizing the duplexes. The mismatch repair proteins MLH1 and MLH3 are then recruited to the double Holliday structure and an unidentified resolvase (Mus81? Gen1?) cleaves the junctions to yield a crossover. Crossovers are not randomly distributed: The histone methyltransferase PRDM9 recruits the recombination machinery to genetically determined hotspots in the genome and each incipient crossover somehow inhibits formation of crossovers nearby, a phenomenon called crossover interference. Each chromosome bivalent, including the X-Y body in males, has at least one crossover and this is required for meiosis to proceed correctly
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AARS Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ABCF2 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID ABL1 Affinity Capture-Western, Biochemical Activity, FRET, Reconstituted Complex, bimolecular fluorescence complementation physical, physical association 12024016 , 17352427 , (Europe PMC )0.37 BioGRID, IntAct, MINT ABLIM3 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID ABRAXAS1 Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Co-localization, Protein-peptide, Reconstituted Complex physical 17525340 , 17643121 , 17643122 , 19261746 , 19261748 , 19261749 , 19305427 , 19766185 , 21282113 , 22357538 , 23416467 , 25184681 , 26778126 , (Europe PMC )NA BioGRID ACACA Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, pull down physical, physical association 12360400 , 16326698 , 16698035 , 18452305 , 19061860 , 24565757 , (Europe PMC )0.52 BioGRID, IntAct ACLY Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ACTG1 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID ACTN3 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID ADRM1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID AFAP1 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID AGL Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID AGO2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID AGO3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID AHCY Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID AHNAK Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID AHR Affinity Capture-Western, Reconstituted Complex physical 18259752 , (Europe PMC )NA BioGRID AIMP1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID AIMP2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID AKAP12 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID AKAP8 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID AKT1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, pull down physical, physical association 10542266 , 19074868 , 21242970 , (Europe PMC )0.40 BioGRID, IntAct ALDH9A1 Affinity Capture-Western, Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID ALDOA Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ALMS1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ANKRD26 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID ANKRD28 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex physical 22990118 , 27026398 , (Europe PMC )NA BioGRID ANKRD44 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID ANXA1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ANXA5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID AP1M1 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID AP2A1 Affinity Capture-Western physical 21880590 , (Europe PMC )NA BioGRID AP2B1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID APEH Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID APEX1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID APLP2 Far Western physical 11746496 , (Europe PMC )NA BioGRID AR Reconstituted Complex, Two-hybrid physical 11016951 , 11085509 , (Europe PMC )NA BioGRID ARFGEF1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ARFGEF2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ARIH1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ARNT Affinity Capture-Western, Reconstituted Complex physical 16567799 , (Europe PMC )NA BioGRID ASH2L Affinity Capture-MS, Two-hybrid physical 22990118 , 26831064 , (Europe PMC )NA BioGRID ATF1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 10945975 , (Europe PMC )NA BioGRID ATM Affinity Capture-Western, Biochemical Activity, Co-purification, Protein-peptide, Reconstituted Complex, proximity-dependent biotin identification association, physical 10550055 , 10608806 , 10783165 , 10866324 , 11114888 , 17478428 , 18344987 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct ATP1B1 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID ATP1B3 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID ATR Affinity Capture-Western, Biochemical Activity, Protein-peptide, Reconstituted Complex, proximity-dependent biotin identification association, physical 10608806 , 11016625 , 11114888 , 11278964 , 17478428 , 23901102 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct ATRIP Affinity Capture-Western, Co-crystal Structure, Reconstituted Complex, proximity-dependent biotin identification association, physical 17616665 , 24073851 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct ATXN2L Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID AURKA Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 14990569 , 22110403 , 26831064 , (Europe PMC )0.35 BioGRID, IntAct AURKC Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID BABAM1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, proximity-dependent biotin identification association, physical 19261746 , 19261749 , 22792303 , 25184681 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct BABAM2 Affinity Capture-MS, Affinity Capture-Western, Co-purification physical 14636569 , 22990118 , 25184681 , (Europe PMC )NA BioGRID BACH1 Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Protein-peptide, Reconstituted Complex physical 11301010 , 15125843 , 15242590 , 16391231 , 17525340 , 17664283 , 19369211 , 25252691 , (Europe PMC )NA BioGRID BAP1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, confocal microscopy, pull down, two hybrid colocalization, physical, physical association 9528852 , (Europe PMC )0.40, 0.54 BioGRID, IntAct BARD1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Co-localization, Co-purification, FRET, PCA, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, gal4 vp16 complementation, nuclear magnetic resonance, proximity-dependent biotin identification, pull down, two hybrid association, direct interaction, physical, physical association 10026184 , 10477523 , 10635334 , 11257228 , 11278247 , 11301010 , 11498787 , 11504724 , 11526114 , 11573085 , 11773071 , 11925436 , 11927591 , 12431996 , 12438698 , 12485996 , 12700228 , 12732733 , 12890688 , 12951069 , 14636569 , 14638690 , 14647430 , 15159397 , 15569676 , 15855157 , 16391231 , 16403807 , 16489000 , 17525341 , 17664283 , 17873885 , 18493658 , 18936166 , 19117993 , 19176389 , 19369211 , 19766185 , 19916563 , 20060929 , 20215511 , 20681793 , 21901007 , 22110403 , 23086937 , 23416467 , 23680151 , 24085845 , 24289923 , 24695549 , 25184681 , 25252691 , 25634209 , 25652403 , 25823446 , 26490435 , 26831064 , 27239795 , 28514442 , 28948225 , 29656893 , 8944023 , 9342365 , 9738006 , 9788437 , 9798686 , (Europe PMC )0.95 BioGRID, IntAct, MINT BCL2 Affinity Capture-Western, FRET, confocal microscopy, proximity ligation assay colocalization, physical, physical association 21444675 , (Europe PMC )0.46 BioGRID, IntAct BECN1 Affinity Capture-Western physical 24378767 , (Europe PMC )NA BioGRID BLM Affinity Capture-MS, Affinity Capture-Western, Co-purification, proximity-dependent biotin identification association, physical 10783165 , 25084169 , 26831064 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct BORA Affinity Capture-MS, Affinity Capture-Western physical 22990118 , 24067368 , (Europe PMC )NA BioGRID BPTF Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID BRAP Reconstituted Complex, Two-hybrid physical 8955125 , 9497340 , (Europe PMC )NA BioGRID BRAT1 Affinity Capture-Western, Co-crystal Structure, Reconstituted Complex, anti bait coimmunoprecipitation, confocal microscopy, pull down, two hybrid colocalization, physical, physical association 16452482 , 24073851 , (Europe PMC )0.60 BioGRID, IntAct BRCA1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, proximity-dependent biotin identification association, physical, physical association 11573086 , 11927591 , 12438698 , 14578343 , 15448696 , 16403807 , 16818604 , 20351172 , 21532592 , 21880590 , 21965653 , 25184681 , 26778126 , 29656893 , 8944023 , 9525870 , (Europe PMC )0.56 BioGRID, IntAct BRCA2 Affinity Capture-MS, Affinity Capture-Western, Co-purification, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, cosedimentation through density gradient, molecular sieving, proximity-dependent biotin identification, tandem affinity purification association, colocalization, physical, physical association 11477095 , 14499622 , 14636569 , 17664283 , 19369211 , 21135251 , 22193777 , 24085845 , 25184681 , 25652403 , 29656893 , 9774970 , (Europe PMC )0.74 BioGRID, IntAct, MINT BRCC3 Affinity Capture-MS, Affinity Capture-Western, Co-purification, anti tag coimmunoprecipitation, proximity-dependent biotin identification association, physical 14636569 , 17664283 , 19202061 , 19305427 , 22990118 , 25184681 , 25252691 , 29656893 , (Europe PMC )0.53 BioGRID, IntAct BRD4 Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID BRD7 Affinity Capture-Western, Co-localization, Two-hybrid physical 20215511 , (Europe PMC )NA BioGRID BRIP1 Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Co-localization, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, molecular sieving, proximity-dependent biotin identification, pull down, surface plasmon resonance, tandem affinity purification association, direct interaction, physical, physical association 11877378 , 14576432 , 14576433 , 14578343 , 15133502 , 15242590 , 17525340 , 17525341 , 17525342 , 17581638 , 17596542 , 18285836 , 18717574 , 19369211 , 19452558 , 20159462 , 20173781 , 20681793 , 21240188 , 22032289 , 23157317 , 23530059 , 24573678 , 25184681 , 26831064 , 27399284 , 29656893 , (Europe PMC )0.94 BioGRID, IntAct, MINT BRSK1 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID BUB3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID C2CD6 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID CABYR Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID CAD Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CAMK2D Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CAND1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CAP1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CAPRIN1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CAPZA1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CAPZB Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID CARM1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CASP1 Affinity Capture-Western, Co-localization physical 26121674 , (Europe PMC )NA BioGRID CASP9 Affinity Capture-Western physical 16322207 , (Europe PMC )NA BioGRID CBX1 Reconstituted Complex physical 25634209 , (Europe PMC )NA BioGRID CBX3 Affinity Capture-MS, Reconstituted Complex physical 25184681 , 25634209 , (Europe PMC )NA BioGRID CBX5 Reconstituted Complex physical 25634209 , (Europe PMC )NA BioGRID CCAR2 Affinity Capture-MS, Affinity Capture-Western physical 20160719 , 26831064 , (Europe PMC )NA BioGRID CCDC120 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID CCNA2 Affinity Capture-Western, Reconstituted Complex physical 10373534 , 9244350 , (Europe PMC )NA BioGRID CCNB1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 23246971 , 9244350 , (Europe PMC )NA BioGRID CCND1 Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, confocal microscopy colocalization, physical, physical association 17334399 , 9244350 , (Europe PMC )0.46 BioGRID, IntAct CCNE1 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 17525332 , (Europe PMC )0.40 BioGRID, IntAct CCNH Affinity Capture-Western physical 15282296 , (Europe PMC )NA BioGRID CCT2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CCT3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CCT4 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CCT5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CCT6A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CCT7 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CCT8 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CDC16 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID CDC25C Biochemical Activity physical 23246971 , (Europe PMC )NA BioGRID CDC37 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CDC5L Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CDCA2 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID CDH1 Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID CDK1 Reconstituted Complex physical 9244350 , (Europe PMC )NA BioGRID CDK16 Affinity Capture-MS, Two-hybrid physical 22990118 , 25184681 , 26186194 , 9738006 , (Europe PMC )NA BioGRID CDK2 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 10373534 , 8764100 , 9244350 , (Europe PMC )NA BioGRID CDK4 Biochemical Activity, Reconstituted Complex physical 12509456 , 17334399 , 9244350 , (Europe PMC )NA BioGRID CDK7 Affinity Capture-Western physical 15282296 , (Europe PMC )NA BioGRID CDK8 Co-purification physical 9159119 , (Europe PMC )NA BioGRID CDK9 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID CDKN2A Affinity Capture-Western, Co-localization physical 18703154 , (Europe PMC )NA BioGRID CDKN2AIP Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID CDKN2D Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 17334399 , (Europe PMC )NA BioGRID CEBPB Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID CENPB Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID CENPF Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CEP350 Affinity Capture-MS, Affinity Capture-Western physical 22990118 , (Europe PMC )NA BioGRID CEP57L1 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID CEP72 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CETN1 Co-localization physical 22833046 , (Europe PMC )NA BioGRID CHD9 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CHEK1 Affinity Capture-Western, Biochemical Activity, Negative Genetic, anti bait coimmunoprecipitation, confocal microscopy colocalization, genetic, physical, physical association 11836499 , 17380128 , 28319113 , (Europe PMC )0.46 BioGRID, IntAct CHEK2 Affinity Capture-Western, Biochemical Activity, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 10724175 , 12438214 , 17380128 , 17525332 , 18804494 , 26121674 , (Europe PMC )0.35 BioGRID, IntAct CKAP5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CLIC1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CLIP1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CLK2 Affinity Capture-Western, Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID CLSPN Affinity Capture-Western, Biochemical Activity physical 15096610 , 22863316 , (Europe PMC )NA BioGRID CLTC Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CMAS Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID CNN2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CNOT1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CNRIP1 Affinity Capture-Western, Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID CNTLN Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID CNTN4 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID COL1A1 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID COMMD1 Affinity Capture-Western, Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID COPA Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID COPB1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID COPB2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID COPE Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID COPG1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CPOX Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CRBN Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CREB1 Phenotypic Enhancement, pull down direct interaction, genetic 10945975 , 9926942 , (Europe PMC )0.44 BioGRID, IntAct, MINT CREB5 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID CREBBP Affinity Capture-Western, Phenotypic Suppression, Reconstituted Complex genetic, physical 10655477 , 11782371 , 12700228 , 16417649 , 16860316 , 9443979 , 9926942 , (Europe PMC )NA BioGRID CRIPAK Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID CRY2 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID CRYZL1 Affinity Capture-Western, Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID CSDE1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CSE1L Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CSNK1D Affinity Capture-MS, Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID CSNK2A1 Reconstituted Complex physical 10403822 , (Europe PMC )NA BioGRID CSNK2B Reconstituted Complex, Two-hybrid physical 10403822 , (Europe PMC )NA BioGRID CSTF1 Reconstituted Complex physical 11257228 , (Europe PMC )NA BioGRID CSTF2 Affinity Capture-Western, Co-purification, anti bait coimmunoprecipitation association, physical 10477523 , 11257228 , (Europe PMC )0.35 BioGRID, IntAct CTBP1 Affinity Capture-Western physical 10196224 , (Europe PMC )NA BioGRID CTCFL Protein-peptide physical 14578343 , (Europe PMC )NA BioGRID CTNNA1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CTNNB1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 20215423 , 26831064 , (Europe PMC )NA BioGRID CTPS1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CUBN Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID CUL2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CWF19L2 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID DALRD3 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID DARS Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DAZAP1 Affinity Capture-RNA physical 18391021 , (Europe PMC )NA BioGRID DBF4 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID DCAF7 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DCLRE1C Affinity Capture-Western physical 15456891 , (Europe PMC )NA BioGRID DCN Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID DCTN1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DDB1 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID DDX1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DDX17 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DDX21 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DDX23 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID DDX24 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID DDX39A Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID DDX5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DDX54 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID DDX6 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DES Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID DHPS Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID DHX15 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DHX9 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 12592385 , 26831064 , 9662397 , (Europe PMC )NA BioGRID DIAPH1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DIMT1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DNAJA1 Affinity Capture-MS, Two-hybrid physical 22990118 , 25184681 , 26831064 , (Europe PMC )NA BioGRID DNAJA2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DNAJA3 Protein-peptide physical 14578343 , (Europe PMC )NA BioGRID DNAJA4 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DNAJB1 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID DNAJC10 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DNHD1 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID DNMT1 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID DPY30 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DRG1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID DSP Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DYNC1H1 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID DYNC1I2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DYRK1A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID E2F1 Affinity Capture-Western physical 21880590 , (Europe PMC )NA BioGRID E2F4 Reconstituted Complex physical 9244350 , (Europe PMC )NA BioGRID EBNA1BP2 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID ECPAS Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EED Reconstituted Complex physical 23624935 , (Europe PMC )NA BioGRID EEF1B2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EEF1D Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EEF1G Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EEF2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EFTUD2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EIF2S1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EIF3A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EIF3B Affinity Capture-MS, Two-hybrid physical 22990118 , 26831064 , (Europe PMC )NA BioGRID EIF3E Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EIF3G Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EIF3H Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EIF3I Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EIF3L Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EIF3M Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EIF4A2 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID EIF4G1 Affinity Capture-MS, Co-fractionation physical 23805307 , 26831064 , (Europe PMC )NA BioGRID EIF5B Affinity Capture-MS, Two-hybrid physical 22990118 , 26831064 , (Europe PMC )NA BioGRID ELK4 Affinity Capture-Western, Reconstituted Complex physical 11313879 , (Europe PMC )NA BioGRID ELOA Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID ENO1 Affinity Capture-MS, Two-hybrid physical 22990118 , 26831064 , (Europe PMC )NA BioGRID EP300 Affinity Capture-Western, Phenotypic Suppression, Reconstituted Complex genetic, physical 10655477 , 11782371 , 19887647 , 21212407 , 22787115 , (Europe PMC )NA BioGRID EPRS Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ERC1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ERCC5 Affinity Capture-Western, Reconstituted Complex physical 26833090 , (Europe PMC )NA BioGRID ERCC6 Affinity Capture-Western, Biochemical Activity physical 21756275 , (Europe PMC )NA BioGRID ERO1B Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID ESR1 Affinity Capture-Western, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, pull down direct interaction, physical, physical association 11244506 , 11493692 , 11782371 , 12400015 , 15674350 , 16061635 , 16860316 , 17505062 , 19887647 , 20060929 , 25499220 , (Europe PMC )0.76 BioGRID, IntAct, MINT ETS1 Reconstituted Complex physical 11313879 , (Europe PMC )NA BioGRID ETV5 FRET physical 21282464 , (Europe PMC )NA BioGRID EWSR1 Affinity Capture-MS, proximity-dependent biotin identification association, physical 26831064 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct EXD2 Affinity Capture-Western physical 26807646 , (Europe PMC )NA BioGRID EXOSC10 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EXOSC8 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EZH2 Affinity Capture-Western, Reconstituted Complex physical 23624935 , 25531315 , (Europe PMC )NA BioGRID EZR Affinity Capture-MS, Affinity Capture-Western physical 21282464 , 26831064 , (Europe PMC )NA BioGRID FAM120A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID FAM161A Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID FAM184A Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID FAM83A Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID FAM98A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID FANCA Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, proximity-dependent biotin identification, two hybrid association, physical, physical association 12354784 , 21240188 , 29656893 , (Europe PMC )0.75 BioGRID, IntAct, MINT FANCD2 Affinity Capture-Western, Biochemical Activity, Two-hybrid, coimmunoprecipitation, fluorescence microscopy, proximity-dependent biotin identification association, colocalization, physical, physical association 11239454 , 12887909 , 14499622 , 25652403 , 29656893 , (Europe PMC )0.60 BioGRID, IntAct, MINT FASN Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID FAU Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID FBL Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID FBXO44 Affinity Capture-Western, Biochemical Activity physical 23086937 , (Europe PMC )NA BioGRID FBXO5 Affinity Capture-Western physical 23086937 , (Europe PMC )NA BioGRID FGFR1OP Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID FHL2 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid physical, physical association 14550570 , 14986435 , 21988832 , 25184681 , (Europe PMC )0.71 BioGRID, IntAct, MINT FKBP4 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID FLI1 Reconstituted Complex physical 11313879 , (Europe PMC )NA BioGRID FLII Affinity Capture-MS, Affinity Capture-Western physical 22990118 , 26831064 , (Europe PMC )NA BioGRID FLNA Affinity Capture-MS physical 22990118 , 26831064 , (Europe PMC )NA BioGRID FLNB Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID FLNC Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID FLT3 Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID FLYWCH1 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID FN3KRP Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID FNTA Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID FOSL2 Affinity Capture-MS, proximity-dependent biotin identification association, physical 25184681 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct FOXO3 Affinity Capture-Western physical 18344987 , (Europe PMC )NA BioGRID FUS Affinity Capture-MS, proximity-dependent biotin identification association, physical 26831064 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct FXR2 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID GANAB Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID GAPDH Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID GAR1 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID GARS Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID GART Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID GATA3 Affinity Capture-Western physical 22120723 , (Europe PMC )NA BioGRID GATAD2B Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID GCC1 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID GCN1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID GEMIN5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID GFI1B Two-hybrid, two hybrid physical, physical association 16713569 , (Europe PMC )0.37 BioGRID, IntAct GGN Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID GIPC1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID GMPS Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID GNL3L Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID GOLGA5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID GOLGA8DP Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID GPI Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID GPN1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID GPN3 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID GPR161 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID GRN Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID GRPEL1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID GTF2E1 Co-purification physical 9159119 , (Europe PMC )NA BioGRID GTF2F1 Co-purification physical 9159119 , (Europe PMC )NA BioGRID GTF2H4 Co-purification physical 9159119 , (Europe PMC )NA BioGRID GTF2I Affinity Capture-Western, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy, pull down colocalization, physical, physical association 21407215 , (Europe PMC )0.61 BioGRID, IntAct GTF2IRD1 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID GTF3C4 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID GTF3C6 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID GUSBP1 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID H2AFX Affinity Capture-Western, Biochemical Activity, Co-localization, Reconstituted Complex, coimmunoprecipitation, confocal microscopy, cosedimentation through density gradient, fluorescence microscopy colocalization, physical, physical association 10959836 , 11927591 , 12419185 , 12485996 , 18001824 , 18001825 , 18344987 , 19766185 , 19805520 , 20681793 , 22193777 , 26121674 , (Europe PMC )0.71 BioGRID, IntAct, MINT H2AFY Co-localization physical 12419249 , (Europe PMC )NA BioGRID HCFC1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HDAC1 Reconstituted Complex physical 10220405 , (Europe PMC )NA BioGRID HDAC2 Affinity Capture-Western, Negative Genetic, Reconstituted Complex genetic, physical 10220405 , 21946536 , 28319113 , (Europe PMC )NA BioGRID HECTD3 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID HERC1 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID HERC2 Affinity Capture-Western, Biochemical Activity physical 20631078 , 25480944 , (Europe PMC )NA BioGRID HGF Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID HIBADH Affinity Capture-Western, Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID HIF1A Affinity Capture-Western physical 16543242 , (Europe PMC )NA BioGRID HIST1H2AB Biochemical Activity physical 25131202 , 25355358 , (Europe PMC )NA BioGRID HIST1H2BG Proximity Label-MS physical 25281560 , (Europe PMC )NA BioGRID HIST2H2AC Biochemical Activity physical 11927591 , 19916563 , (Europe PMC )NA BioGRID HIST2H3C Co-localization physical 12419249 , (Europe PMC )NA BioGRID HIVEP1 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct HLTF Affinity Capture-Western physical 23901102 , (Europe PMC )NA BioGRID HMMR Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation association, physical, physical association 22110403 , 25184681 , 26831064 , (Europe PMC )0.50 BioGRID, IntAct HNRNPA0 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HNRNPA1 Affinity Capture-RNA, proximity-dependent biotin identification association, physical 18391021 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct HNRNPA2B1 Affinity Capture-MS, Affinity Capture-RNA, proximity-dependent biotin identification association, physical 18391021 , 26831064 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct HNRNPA3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HNRNPAB Affinity Capture-MS, proximity-dependent biotin identification association, physical 26831064 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct HNRNPC Protein-RNA physical 23585894 , (Europe PMC )NA BioGRID HNRNPD Affinity Capture-MS, Affinity Capture-RNA, Two-hybrid physical 15231747 , 22431556 , 26831064 , (Europe PMC )NA BioGRID HNRNPDL Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HNRNPF Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HNRNPH1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HNRNPH2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HNRNPH3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HNRNPK Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HNRNPL Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HNRNPM Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HNRNPR Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HNRNPU Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HNRNPUL1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HNRNPUL2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HORMAD1 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID HP1BP3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HSP90AA1 Affinity Capture-MS, Affinity Capture-Western physical 24085845 , 26831064 , (Europe PMC )NA BioGRID HSP90AB1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HSP90AB2P Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HSP90B1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HSPA14 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID HSPA1L Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HSPA4 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HSPA4L Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HSPA5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HSPA8 Affinity Capture-MS, Two-hybrid physical 26831064 , 9738006 , (Europe PMC )NA BioGRID HSPA9 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HSPB1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HSPD1 Affinity Capture-Western, Two-hybrid, pull down, two hybrid physical, physical association 21988832 , (Europe PMC )0.51 BioGRID, IntAct HSPH1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HUWE1 Affinity Capture-Western physical 24342616 , (Europe PMC )NA BioGRID HYOU1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID IARS Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID IFI16 Affinity Capture-Western, Co-localization, anti bait coimmunoprecipitation, confocal microscopy, pull down colocalization, physical, physical association 14654789 , 26121674 , (Europe PMC )0.56 BioGRID, IntAct IFI30 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID IGF2BP3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ILF2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ILF3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID IMPDH2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID INPP1 Affinity Capture-Western, Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID IPO5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID IPO7 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID IQGAP1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ITIH5 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID ITPR1 Affinity Capture-Western, Co-fractionation, FRET, Reconstituted Complex physical 25645916 , (Europe PMC )NA BioGRID ITPRID2 Affinity Capture-MS, Two-hybrid physical 22990118 , 26831064 , (Europe PMC )NA BioGRID JAK1 Affinity Capture-Western, coimmunoprecipitation physical, physical association 11163768 , (Europe PMC )0.40 BioGRID, IntAct, MINT JAK2 Affinity Capture-Western, coimmunoprecipitation physical, physical association 11163768 , (Europe PMC )0.40 BioGRID, IntAct, MINT JUN Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 12080089 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT JUNB Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 12080089 , 18259752 , 25184681 , 28514442 , (Europe PMC )NA BioGRID JUND Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 12080089 , (Europe PMC )NA BioGRID JUP Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct KARS Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID KAT5 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID KDM1A Affinity Capture-MS, Affinity Capture-Western, Two-hybrid physical 22990118 , 26831064 , (Europe PMC )NA BioGRID KEAP1 Affinity Capture-Western physical 22331464 , (Europe PMC )NA BioGRID KHDRBS1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID KHSRP Affinity Capture-MS, proximity-dependent biotin identification association, physical 26831064 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct KIF11 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID KIF1B Protein-peptide physical 14578343 , (Europe PMC )NA BioGRID KIF20A Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID KIF20B Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID KIF22 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID KIF23 Affinity Capture-MS, proximity-dependent biotin identification association, physical 26831064 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct KIF5B Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID KIFC1 Affinity Capture-MS, proximity-dependent biotin identification association, physical 26831064 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct KLHL22 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID KPNA2 Affinity Capture-MS, Two-hybrid, pull down, two hybrid physical, physical association 25184681 , 26831064 , 8955125 , 9497340 , (Europe PMC )0.51 BioGRID, IntAct KPNA3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID KPNB1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID KRT18 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID LARP1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID LARS Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID LCK Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID LCMT1 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID LDHA Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID LDHB Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID LDHC Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID LGALS3 Affinity Capture-Western physical 24755837 , (Europe PMC )NA BioGRID LGALS3BP Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID LMNA Affinity Capture-MS, cosedimentation through density gradient colocalization, physical 22193777 , 26831064 , (Europe PMC )0.35 BioGRID, IntAct, MINT LMNB1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID LMNTD1 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID LMO4 Affinity Capture-Western, Phenotypic Suppression, Reconstituted Complex, Two-hybrid genetic, physical 11751867 , 12925972 , (Europe PMC )NA BioGRID LONRF1 Two-hybrid, two hybrid array physical, physical association 22493164 , (Europe PMC )0.37 BioGRID, IntAct LRRC59 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID LRRFIP1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID LRRK1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MAGEB2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MAN2C1 Affinity Capture-Western, Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID MAP3K1 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID MAP3K14 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID MAP3K21 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MAP3K3 Affinity Capture-Western, Two-hybrid physical 15205325 , (Europe PMC )NA BioGRID MAP4 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MAP4K4 Protein-peptide physical 14578343 , (Europe PMC )NA BioGRID MAPK1 Affinity Capture-Western physical 18593910 , (Europe PMC )NA BioGRID MAPK3 Affinity Capture-Western physical 18593910 , (Europe PMC )NA BioGRID MAPKAP1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID MARCKSL1 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID MARS Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MATK Affinity Capture-Western physical 23901102 , (Europe PMC )NA BioGRID MATR3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MCM2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MCM3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MCM4 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MCM5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MCM6 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MCRS1 Affinity Capture-Western, Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID MDC1 Affinity Capture-Western, Co-localization, anti bait coimmunoprecipitation, imaging technique, proximity-dependent biotin identification association, colocalization, physical, physical association 12607005 , 12611903 , 15569676 , 17525332 , 19766185 , 21622030 , 29656893 , (Europe PMC )0.65 BioGRID, IntAct MDH1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MDH2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MED17 Co-purification physical 11504724 , 12154023 , (Europe PMC )NA BioGRID MED21 Affinity Capture-Western, Co-purification physical 9159119 , (Europe PMC )NA BioGRID MID2 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID MKI67 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID MKRN2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MLH1 Affinity Capture-MS, Affinity Capture-Western, Co-purification, anti bait coimmunoprecipitation, proximity-dependent biotin identification association, physical 10783165 , 17148452 , 21240188 , 25184681 , 29656893 , (Europe PMC )0.53 BioGRID, IntAct, MINT MNAT1 Affinity Capture-Western, Two-hybrid, two hybrid array physical, physical association 15282296 , 22493164 , (Europe PMC )0.37 BioGRID, IntAct MORF4L1 Affinity Capture-Western, cosedimentation through density gradient colocalization, physical 20332121 , 22193777 , (Europe PMC )0.35 BioGRID, IntAct, MINT MORF4L2 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID MOV10 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MRE11 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Co-purification, Reconstituted Complex physical 10426999 , 10783165 , 11353843 , 11504724 , 16391231 , 17349954 , 23530059 , 25184681 , (Europe PMC )NA BioGRID MRM2 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID MRPL36 Affinity Capture-Western physical 16462773 , (Europe PMC )NA BioGRID MSH2 Affinity Capture-Western, Co-purification, Phenotypic Suppression, Reconstituted Complex, Two-hybrid genetic, physical 10783165 , 11498787 , 15886699 , 24966277 , (Europe PMC )NA BioGRID MSH3 Protein-peptide, Reconstituted Complex physical 11498787 , 14578343 , (Europe PMC )NA BioGRID MSH6 Affinity Capture-MS, Co-purification, Reconstituted Complex, Two-hybrid physical 10783165 , 11498787 , 25184681 , (Europe PMC )NA BioGRID MSN Affinity Capture-MS physical 21282464 , (Europe PMC )NA BioGRID MTA2 Affinity Capture-MS physical 19703393 , 25184681 , (Europe PMC )NA BioGRID MTHFD1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MTOR Affinity Capture-Western physical 22990118 , (Europe PMC )NA BioGRID MVP Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MYBBP1A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MYC Affinity Capture-Western, Co-localization, Reconstituted Complex, Two-hybrid physical 11916966 , 12646176 , 14612409 , 20215511 , 9788437 , (Europe PMC )NA BioGRID MYH10 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MYH14 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MYH9 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MYL12A Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID MYOZ1 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID NAA15 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NABP2 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID NACA Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NAP1L1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NAT10 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID NBN Affinity Capture-MS, Affinity Capture-Western, Co-localization, Co-purification, proximity-dependent biotin identification association, physical 10426999 , 10783165 , 11504724 , 18171670 , 19244116 , 25184681 , 25659039 , 25939603 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct NCL Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NCOA1 Affinity Capture-Western, Reconstituted Complex physical 16860316 , (Europe PMC )NA BioGRID NCOA2 Protein-peptide, Reconstituted Complex physical 11085509 , 14578343 , 16860316 , (Europe PMC )NA BioGRID NCOA3 Affinity Capture-Western, Protein-peptide, Reconstituted Complex physical 14578343 , 16860316 , (Europe PMC )NA BioGRID ND1 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID NDC1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NELFB Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, confocal microscopy, pull down, two hybrid colocalization, physical, physical association 11739404 , (Europe PMC )0.60 BioGRID, IntAct NFE2L2 Affinity Capture-Western physical 23857982 , (Europe PMC )NA BioGRID NFYA Affinity Capture-Western physical 11777930 , (Europe PMC )NA BioGRID NINL Affinity Capture-Western physical 19509300 , (Europe PMC )NA BioGRID NIPBL Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID NKAPL Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID NKRF Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NME1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NMI Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 11916966 , (Europe PMC )NA BioGRID NOL11 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID NOLC1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NOP2 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID NOP56 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NPC2 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID NPEPPS Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NPM1 Affinity Capture-MS, Affinity Capture-Western physical 15184379 , 26831064 , (Europe PMC )NA BioGRID NRIP1 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID NSF Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NUDC Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NUFIP1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 15107825 , (Europe PMC )NA BioGRID NUFIP2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NUMA1 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID NUP107 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NUP133 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NUP153 Affinity Capture-MS, Protein-peptide physical 14578343 , 26831064 , (Europe PMC )NA BioGRID NUP155 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NUP160 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NUP214 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NUP93 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID OBSCN Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID ODF2 Co-localization physical 22833046 , (Europe PMC )NA BioGRID OGFR Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID OGT Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID OLA1 Affinity Capture-Western, Reconstituted Complex physical 24289923 , (Europe PMC )NA BioGRID ORC2 Affinity Capture-MS, Affinity Capture-Western physical 17525332 , 25184681 , (Europe PMC )NA BioGRID ORC3 Affinity Capture-Western, anti tag coimmunoprecipitation physical, physical association 17525332 , (Europe PMC )0.40 BioGRID, IntAct P4HB Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PA2G4 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PABPC1 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Far Western, Reconstituted Complex physical 16782705 , 23805307 , 26831064 , (Europe PMC )NA BioGRID PABPC4 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PAICS Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PALB2 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, cosedimentation through density gradient, molecular sieving, proximity-dependent biotin identification, pull down, tandem affinity purification association, colocalization, physical, physical association 19268590 , 19369211 , 19553677 , 19584259 , 22193777 , 22331464 , 23038782 , 23585894 , 24085845 , 25016020 , 25184681 , 25652403 , 26649820 , 29656893 , (Europe PMC )0.87 BioGRID, IntAct, MINT PALLD Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PARG Biochemical Activity physical 25252691 , (Europe PMC )NA BioGRID PARP1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Negative Genetic, Synthetic Lethality genetic, physical 25252691 , 26831064 , 27453043 , 28319113 , (Europe PMC )NA BioGRID PARP4 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PAX2 Affinity Capture-Western physical 21880590 , (Europe PMC )NA BioGRID PCBP1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PCBP2 Affinity Capture-RNA physical 22431556 , (Europe PMC )NA BioGRID PCLAF Affinity Capture-Western physical 21673012 , (Europe PMC )NA BioGRID PCMT1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PCMTD2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PCNA Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID PDCD6IP Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PDE12 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PDGFRA Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID PDIA4 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PDLIM5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PDS5A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PEG3 Far Western physical 11746496 , (Europe PMC )NA BioGRID PEX5 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct PFKL Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PFKM Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PFKP Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PFN1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PGAM5 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID PGD Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PGK1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PGR Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 16109739 , 21531767 , (Europe PMC )NA BioGRID PHB2 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID PHF12 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID PHGDH Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PIAS1 Biochemical Activity, Co-localization, proximity-dependent biotin identification association, physical 20016594 , 20016603 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct PIAS4 Biochemical Activity, Co-localization physical 20016594 , 20016603 , (Europe PMC )NA BioGRID PIK3R1 Reconstituted Complex, peptide array physical, physical association 16135792 , 17474147 , (Europe PMC )0.40 BioGRID, IntAct PILRB Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID PISD Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID PKM Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PLEC Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PLK1 Affinity Capture-Western, proximity-dependent biotin identification association, physical 24067368 , 25483079 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct PMS2 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID POLH Affinity Capture-Western physical 23901102 , (Europe PMC )NA BioGRID POLN Affinity Capture-MS, Affinity Capture-Western physical 26269593 , (Europe PMC )NA BioGRID POLR1A Affinity Capture-Western physical 27589844 , (Europe PMC )NA BioGRID POLR2A Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-purification, Reconstituted Complex physical 11504724 , 12955082 , 14506230 , 15886201 , 18197258 , 22990118 , 25184681 , 27583302 , 9159119 , (Europe PMC )NA BioGRID POLR2C Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID POLR2D Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID POLR2E Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID POLR2G Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID POLR2H Biochemical Activity physical 17283126 , 25436519 , (Europe PMC )NA BioGRID POLR2I Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID POLR2J Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID POLR2M Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID POM121 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID POMGNT1 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct POU2F1 Affinity Capture-Western, Co-localization physical 11777930 , 18000219 , 20215511 , (Europe PMC )NA BioGRID PPA1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PPFIA1 Affinity Capture-Western, Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID PPHLN1 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID PPP1CA Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 12438214 , 17511879 , 22990118 , 25056273 , (Europe PMC )0.52 BioGRID, IntAct PPP1CB Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, two hybrid physical, physical association 17511879 , (Europe PMC )0.58 BioGRID, IntAct PPP1R13B Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID PPP1R18 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID PPP1R3A Affinity Capture-Western physical 17511879 , (Europe PMC )NA BioGRID PPP1R9B Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID PPP2CA Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID PPP2R5C Affinity Capture-Western, Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID PPP6C Affinity Capture-MS, Affinity Capture-Western physical 22990118 , 26831064 , (Europe PMC )NA BioGRID PPP6R1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID PPP6R3 Affinity Capture-MS, Affinity Capture-Western physical 22990118 , 26831064 , (Europe PMC )NA BioGRID PRDX1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PREP Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID PRKAA2 Affinity Capture-Western, Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID PRKAG3 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID PRKCSH Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PRKDC Protein-peptide physical 10608806 , (Europe PMC )NA BioGRID PRKRA Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PRMT1 Affinity Capture-MS, Biochemical Activity, Reconstituted Complex physical 20614009 , 26831064 , (Europe PMC )NA BioGRID PRMT5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PRPF19 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PRPF3 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID PRPF39 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PRPF6 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PRR5 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID PSAP Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID PSMA1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMA5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMA6 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID PSMA7 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Far Western physical 25620702 , 26831064 , (Europe PMC )NA BioGRID PSMB5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMC1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMC2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMC3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMC4 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMC5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMC6 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMD1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMD11 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMD12 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMD13 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMD14 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMD2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMD3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMD4 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMD6 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMD7 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMD9 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID PSME3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMG1 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID PTBP1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PYCARD Affinity Capture-Western, Co-localization physical 26121674 , (Europe PMC )NA BioGRID PYGL Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID QARS Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RACK1 Affinity Capture-MS physical 22990118 , 26831064 , (Europe PMC )NA BioGRID RAD18 Affinity Capture-MS, Affinity Capture-Western, proximity-dependent biotin identification association, physical 23901102 , 25184681 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct RAD21 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID RAD23B Affinity Capture-MS, pull down physical, physical association 16712842 , (Europe PMC )0.40 BioGRID, IntAct, MINT RAD50 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Co-purification, Reconstituted Complex, Two-hybrid, proximity-dependent biotin identification association, physical 10426999 , 10783165 , 11504724 , 16391231 , 18171670 , 25084169 , 25184681 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct RAD51 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Co-purification, Reconstituted Complex, cosedimentation through density gradient, molecular sieving, proximity-dependent biotin identification association, colocalization, physical, physical association 11498787 , 14636569 , 19369211 , 19766185 , 22193777 , 24085845 , 25499220 , 25659039 , 29656893 , 9008167 , 9774970 , (Europe PMC )0.67 BioGRID, IntAct, MINT RALY Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RAN Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RANBP9 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID RANGAP1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RARS Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RB1 Affinity Capture-Western, Co-localization, Negative Genetic, Reconstituted Complex genetic, physical 10220405 , 10518542 , 11521194 , 28319113 , (Europe PMC )NA BioGRID RBBP4 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 10220405 , 26831064 , (Europe PMC )NA BioGRID RBBP5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RBBP7 Affinity Capture-Western, Far Western, Reconstituted Complex, Two-hybrid physical 10220405 , 11394910 , 11746496 , (Europe PMC )NA BioGRID RBBP8 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-localization, Protein-peptide, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, molecular sieving, proximity-dependent biotin identification, pull down, tandem affinity purification, two hybrid association, physical, physical association 10196224 , 10764811 , 10910365 , 11689934 , 11739404 , 14578343 , 16818604 , 16843262 , 17525340 , 17525342 , 18171670 , 18285836 , 19369211 , 19452558 , 20351172 , 21908405 , 23416467 , 24085845 , 25184681 , 25252691 , 25310973 , 25659039 , 26387952 , 26446986 , 29656893 , 9738006 , 9811458 , (Europe PMC )0.87 BioGRID, IntAct RBL1 Co-localization, Reconstituted Complex physical 11521194 , (Europe PMC )NA BioGRID RBL2 Co-localization, Reconstituted Complex physical 11521194 , (Europe PMC )NA BioGRID RBM14 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RBM28 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID RBM6 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RCC1L Affinity Capture-Western, Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID RCHY1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RCL1 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID RDX Affinity Capture-MS physical 21282464 , (Europe PMC )NA BioGRID RECQL5 Affinity Capture-MS, proximity-dependent biotin identification association, physical 22990118 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct RELA Affinity Capture-Western, Reconstituted Complex physical 12700228 , 21908405 , (Europe PMC )NA BioGRID REV1 Affinity Capture-Western physical 23901102 , (Europe PMC )NA BioGRID RFC1 Affinity Capture-MS, Co-purification physical 10783165 , 25184681 , (Europe PMC )NA BioGRID RFC2 Affinity Capture-MS physical 22990118 , 25184681 , (Europe PMC )NA BioGRID RFC4 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID RICTOR Affinity Capture-MS, Affinity Capture-Western physical 22990118 , (Europe PMC )NA BioGRID RNF169 Affinity Capture-MS, proximity-dependent biotin identification association, physical 25184681 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct RNF216 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID RNGTT Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID RNMT Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPA1 Affinity Capture-Western, Co-localization, anti bait coimmunoprecipitation, molecular sieving, proximity-dependent biotin identification association, physical, physical association 19369211 , 19766185 , 21240188 , 23901102 , 29656893 , (Europe PMC )0.67 BioGRID, IntAct, MINT RPAP2 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID RPAP3 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID RPGRIP1 Affinity Capture-Western, Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID RPL10 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL10A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL11 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL12 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL14 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL15 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL17 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL18 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL18A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL21 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID RPL23 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL23A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL24 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL27 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL27A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL28 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID RPL29 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL3 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID RPL30 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL31 Affinity Capture-MS, Far Western, Reconstituted Complex physical 11746496 , 26831064 , (Europe PMC )NA BioGRID RPL32 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID RPL34 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID RPL35 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL36 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL37A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL4 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL6 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL7 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL7A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL8 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL9 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPLP1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPLP2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPRD1A Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID RPRD1B Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID RPS11 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS12 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS13 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID RPS14 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS15A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS16 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS18 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS19 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS23 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS24 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS25 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS27 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID RPS3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS3A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS6 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS7 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID RPS8 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS9 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPSA Affinity Capture-MS, Co-localization physical 22814251 , 26831064 , (Europe PMC )NA BioGRID RPTOR Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RSL1D1 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID RTKN2 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID RTL10 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID RUNX1 Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID RUNX1T1 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID RUVBL1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RUVBL2 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID RWDD2B Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID RWDD4 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID SART3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SDK2 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID SEC13 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SEC16A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SEC23A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SEC23B Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SEC23IP Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SEC24B Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SEC24C Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SEC31A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SEM1 Two-hybrid physical 17563742 , (Europe PMC )NA BioGRID SEPT2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SEPT7 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SEPT9 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SERPINH1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SETD1A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SETX Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Synthetic Growth Defect, Two-hybrid genetic, physical 25184681 , 25699710 , (Europe PMC )NA BioGRID SF3A1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SF3A3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SF3B1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SF3B2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SF3B3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SFPQ Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SH2B1 Affinity Capture-Western physical 17565041 , (Europe PMC )NA BioGRID SKP1 Affinity Capture-Western physical 23086937 , (Europe PMC )NA BioGRID SKP2 Affinity Capture-Western, Biochemical Activity physical 23086937 , 25659039 , (Europe PMC )NA BioGRID SLAIN2 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID SLC39A10 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SLC39A6 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SMAD3 Affinity Capture-Western, Reconstituted Complex physical 15735739 , 19768112 , (Europe PMC )NA BioGRID SMARCA2 Affinity Capture-Western physical 15034933 , 27591253 , (Europe PMC )NA BioGRID SMARCA4 Affinity Capture-MS, Affinity Capture-Western, Co-purification, Reconstituted Complex physical 10943845 , 15034933 , 23438604 , 26831064 , (Europe PMC )NA BioGRID SMARCA5 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID SMARCB1 Affinity Capture-Western, Co-purification physical 10943845 , 27591253 , (Europe PMC )NA BioGRID SMARCC1 Affinity Capture-MS, Co-purification physical 10943845 , 26831064 , (Europe PMC )NA BioGRID SMARCC2 Affinity Capture-MS, Co-purification physical 10943845 , 26831064 , (Europe PMC )NA BioGRID SMARCD2 Co-purification physical 10943845 , (Europe PMC )NA BioGRID SMC1A Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 11877377 , 25184681 , 26831064 , (Europe PMC )0.40 BioGRID, IntAct SMC3 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID SND1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SNRNP200 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid physical 22990118 , 26831064 , (Europe PMC )NA BioGRID SNRPD3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SNX3 Affinity Capture-Western, Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID SNX6 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID SNX9 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SOX30 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID SP1 Affinity Capture-Western, Reconstituted Complex physical 12706836 , 17766039 , (Europe PMC )NA BioGRID SPAG9 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SPATA4 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID SPTAN1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SPTBN1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SRP68 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SRP72 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SRSF1 Affinity Capture-MS, Affinity Capture-RNA physical 18391021 , 22990118 , (Europe PMC )NA BioGRID SSB Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SSRP1 Co-localization, Synthetic Growth Defect genetic, physical 25184681 , (Europe PMC )NA BioGRID SSX2IP Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID STAC2 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID STAT1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 10792030 , (Europe PMC )NA BioGRID STAT5A Affinity Capture-Western physical 12459499 , (Europe PMC )NA BioGRID STAU1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID STIP1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID STRAP Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID STRN Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID SUMO1 Affinity Capture-MS, Affinity Capture-Western, FRET, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, fluorescent resonance energy transfer, pull down direct interaction, physical, physical association 18025037 , 20016594 , 26831064 , (Europe PMC )0.60 BioGRID, IntAct SUMO2 Affinity Capture-MS physical 22689573 , (Europe PMC )NA BioGRID SUPT16H Affinity Capture-MS, Co-localization, Synthetic Growth Defect genetic, physical 25184681 , 26831064 , (Europe PMC )NA BioGRID SUPT5H Affinity Capture-Western physical 18197258 , (Europe PMC )NA BioGRID SUPT6H Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID SUZ12 Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 23624935 , (Europe PMC )0.35 BioGRID, IntAct, MINT SYNCRIP Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SYT6 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID TAF15 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TAF1B Affinity Capture-Western physical 27589844 , (Europe PMC )NA BioGRID TALDO1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TARDBP Affinity Capture-RNA physical 18391021 , (Europe PMC )NA BioGRID TARS Affinity Capture-MS, Two-hybrid physical 22990118 , 26831064 , (Europe PMC )NA BioGRID TATDN2 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID TBL3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TCEA2 Synthetic Growth Defect, Two-hybrid genetic, physical 25184681 , (Europe PMC )NA BioGRID TCEANC Synthetic Growth Defect, Two-hybrid genetic, physical 25184681 , (Europe PMC )NA BioGRID TCOF1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TCP1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TCTEX1D2 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID TERF1 Affinity Capture-Western, proximity-dependent biotin identification association, physical 19797051 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct TERF2 Affinity Capture-MS, Affinity Capture-Western, proximity-dependent biotin identification association, physical 19797051 , 25184681 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct TEX101 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID TFAP2A Affinity Capture-Western physical 21363924 , (Europe PMC )NA BioGRID TFAP2C Affinity Capture-Western physical 21363924 , (Europe PMC )NA BioGRID TFAP4 Affinity Capture-MS physical 19505873 , (Europe PMC )NA BioGRID TFG Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TFRC Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID THEGL Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID THOC3 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID TIAL1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TKT Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TLE4 Affinity Capture-Western, Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID TLN1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TMPRSS12 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID TNPO1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TNRC6A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TNRC6B Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TNRC6C Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TNS2 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID TONSL Affinity Capture-MS, Affinity Capture-Western, Co-localization, Synthetic Growth Defect, proximity-dependent biotin identification association, genetic, physical 25184681 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct TOP1 Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID TOP2A Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, pull down physical, physical association 15965487 , 25184681 , (Europe PMC )0.52 BioGRID, IntAct TOPBP1 Affinity Capture-MS, Affinity Capture-Western, Co-localization, proximity-dependent biotin identification association, physical 16391231 , 19766185 , 23157317 , 23901102 , 25184681 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct TP53 Affinity Capture-MS, Affinity Capture-Western, Co-purification, Reconstituted Complex, coimmunoprecipitation, pull down direct interaction, physical, physical association 14636569 , 14710355 , 15571721 , 16677609 , 16969499 , 19509300 , 21742769 , 26140185 , 9482880 , 9582019 , 9926942 , (Europe PMC )0.54 BioGRID, IntAct, MINT TP53BP1 Affinity Capture-MS, Affinity Capture-Western, Co-localization physical 12364621 , 17525332 , 21552324 , 26831064 , (Europe PMC )NA BioGRID TP63 Affinity Capture-Western, Co-localization physical 21363924 , 24556685 , (Europe PMC )NA BioGRID TP73 Affinity Capture-Western physical 20807817 , (Europe PMC )NA BioGRID TPI1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TPM1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID TPM3 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID TPP2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TPR Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TPTE2 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID TPX2 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, proximity-dependent biotin identification association, physical 22110403 , 25184681 , 29656893 , (Europe PMC )0.53 BioGRID, IntAct TRA2B Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TRIM24 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct TRIM25 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TRIM28 Affinity Capture-MS, proximity-dependent biotin identification association, physical 26831064 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct TRIM46 Two-hybrid, two hybrid array physical, physical association 22493164 , (Europe PMC )0.37 BioGRID, IntAct TRIM74 Two-hybrid, two hybrid array physical, physical association 22493164 , (Europe PMC )0.37 BioGRID, IntAct TRNAU1AP Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TROAP Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TSEN54 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID TSGA10IP Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID TTN Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TUBA1C Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TUBA4A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TUBB Affinity Capture-MS, Affinity Capture-Western physical 12353262 , 26831064 , (Europe PMC )NA BioGRID TUBB3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TUBB4B Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TUBB6 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TUBB8 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TUBG1 Affinity Capture-Western, Biochemical Activity, Co-localization, Co-purification, Reconstituted Complex physical 11691781 , 15367667 , 22262852 , 22833046 , 24289923 , 9789027 , (Europe PMC )NA BioGRID TULP2 Affinity Capture-Western, Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID TXLNA Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID UBA1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID UBAP2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID UBAP2L Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID UBC Biochemical Activity, Reconstituted Complex physical 17349954 , 17525341 , (Europe PMC )NA BioGRID UBE2D1 Co-crystal Structure, Reconstituted Complex, Two-hybrid physical 11278247 , 12485996 , 12732733 , 12887909 , 12890688 , 14636569 , 14638690 , 16403807 , 19712108 , 19916563 , 24507701 , (Europe PMC )NA BioGRID UBE2D2 Co-crystal Structure, Reconstituted Complex, Two-hybrid physical 19712108 , 21113135 , (Europe PMC )NA BioGRID UBE2D3 Affinity Capture-Western, Co-crystal Structure, Reconstituted Complex, Two-hybrid physical 11927591 , 12438698 , 15367667 , 15886201 , 15905410 , 16628214 , 16818604 , 17283126 , 17349954 , 19712108 , 20351172 , 21113135 , 21531767 , 21532592 , 21756275 , 21965653 , 22863316 , 23246971 , 25355358 , (Europe PMC )NA BioGRID UBE2E1 Co-crystal Structure, Reconstituted Complex, Two-hybrid physical 17873885 , 19712108 , 21965653 , (Europe PMC )NA BioGRID UBE2E2 Co-crystal Structure, Reconstituted Complex, Two-hybrid physical 17873885 , 19712108 , 21965653 , (Europe PMC )NA BioGRID UBE2E3 Co-crystal Structure, Reconstituted Complex, Two-hybrid physical 17873885 , 19712108 , 21965653 , (Europe PMC )NA BioGRID UBE2I Affinity Capture-Western, Biochemical Activity, FRET physical 19287951 , 20016594 , (Europe PMC )NA BioGRID UBE2J1 Two-hybrid, two hybrid array physical, physical association 19690564 , (Europe PMC )0.37 BioGRID, IntAct UBE2K Co-crystal Structure, Reconstituted Complex, Two-hybrid physical 17873885 , 19712108 , 21965653 , 23246971 , (Europe PMC )NA BioGRID UBE2L3 Co-crystal Structure, Reconstituted Complex, Two-hybrid physical 12732733 , 19712108 , (Europe PMC )NA BioGRID UBE2N Co-crystal Structure, Reconstituted Complex, Two-hybrid physical 17873885 , 19712108 , 21965653 , (Europe PMC )NA BioGRID UBE2T Reconstituted Complex physical 19887602 , (Europe PMC )NA BioGRID UBE2W Co-crystal Structure, Reconstituted Complex, Two-hybrid physical 17873885 , 19712108 , 21965653 , 25436519 , (Europe PMC )NA BioGRID UBE3A Reconstituted Complex physical 12890688 , (Europe PMC )NA BioGRID UBR1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID UBR2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID UBTF Affinity Capture-Western physical 27589844 , (Europe PMC )NA BioGRID UBXN1 Affinity Capture-Western, Reconstituted Complex physical 20351172 , (Europe PMC )NA BioGRID UCHL5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID UGGT1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID UIMC1 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation, fluorescence microscopy, proximity-dependent biotin identification, pull down, tandem affinity purification association, colocalization, direct interaction, physical, physical association 17525340 , 17525341 , 17525342 , 17621610 , 17643121 , 19261748 , 19305427 , 19615732 , 19766185 , 21622030 , 24085845 , 25184681 , 25252691 , 26446986 , 28569838 , 29656893 , (Europe PMC )0.40, 0.72 BioGRID, IntAct UPF1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID USF2 Affinity Capture-Western physical 14502648 , (Europe PMC )NA BioGRID USH2A Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID USO1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID USP2 Two-hybrid physical 22990118 , 23105109 , (Europe PMC )NA BioGRID USP37 Proximity Label-MS physical 26299517 , (Europe PMC )NA BioGRID USP7 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID UTP4 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID VARS Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID VCL Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID VCP Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 10855792 , 26831064 , (Europe PMC )NA BioGRID VDR Affinity Capture-Western physical 19074549 , (Europe PMC )NA BioGRID VEGFA Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID VPS35 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID VSIG8 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID WAPL Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID WDR48 Affinity Capture-MS physical 19615732 , (Europe PMC )NA BioGRID WDR5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID WDR6 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID WEE1 Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID WIZ Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID WNT2B Far Western physical 11746496 , (Europe PMC )NA BioGRID WWOX Affinity Capture-Western, Reconstituted Complex physical 27869163 , (Europe PMC )NA BioGRID XIAP Affinity Capture-Western, Reconstituted Complex physical 16322207 , (Europe PMC )NA BioGRID XIST Co-localization physical 12419249 , 15065664 , (Europe PMC )NA BioGRID XPO1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID XRCC5 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 18936166 , 23344954 , 26831064 , (Europe PMC )NA BioGRID XRCC6 Affinity Capture-MS physical 22990118 , 26831064 , (Europe PMC )NA BioGRID XRN2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID YBX1 Affinity Capture-MS physical 22990118 , 26831064 , (Europe PMC )NA BioGRID YTHDF3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID YWHAE Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID YWHAQ Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID YWHAZ Affinity Capture-MS physical 22990118 , 26831064 , (Europe PMC )NA BioGRID ZBTB14 Affinity Capture-Western physical 21880590 , (Europe PMC )NA BioGRID ZBTB47 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ZC3H11A Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID ZC3HAV1 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID ZCCHC8 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 17525332 , (Europe PMC )0.52 BioGRID, IntAct ZDHHC5 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID ZFR Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ZMIZ1 Affinity Capture-MS physical 26522984 , (Europe PMC )NA BioGRID ZNF280D Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID ZNF326 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ZNF350 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, coimmunoprecipitation, pull down, two hybrid physical, physical association 11090615 , 16843262 , 23991171 , (Europe PMC )0.58 BioGRID, IntAct ZNF423 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID ZNF827 Co-localization, proximity-dependent biotin identification association, physical 25150861 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct ZSCAN21 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID ZYG11B Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ZZZ3 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABRAXAS1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy, proximity-dependent biotin identification, pull down, surface plasmon resonance association, colocalization, direct interaction, physical association 17525340 , 17643121 , 29656893 , (Europe PMC )0.82 IntAct ACACA Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, pull down physical, physical association 12360400 , 16326698 , 16698035 , 18452305 , 19061860 , 24565757 , (Europe PMC )0.52 BioGRID, IntAct ACD proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct AKT1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, pull down physical, physical association 10542266 , 19074868 , 21242970 , (Europe PMC )0.40 BioGRID, IntAct ANLN proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct ARID1A proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct ATM Affinity Capture-Western, Biochemical Activity, Co-purification, Protein-peptide, Reconstituted Complex, proximity-dependent biotin identification association, physical 10550055 , 10608806 , 10783165 , 10866324 , 11114888 , 17478428 , 18344987 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct ATR Affinity Capture-Western, Biochemical Activity, Protein-peptide, Reconstituted Complex, proximity-dependent biotin identification association, physical 10608806 , 11016625 , 11114888 , 11278964 , 17478428 , 23901102 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct ATRIP Affinity Capture-Western, Co-crystal Structure, Reconstituted Complex, proximity-dependent biotin identification association, physical 17616665 , 24073851 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct AURKA Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 14990569 , 22110403 , 26831064 , (Europe PMC )0.35 BioGRID, IntAct BABAM1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, proximity-dependent biotin identification association, physical 19261746 , 19261749 , 22792303 , 25184681 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct BABAM2 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct BAP1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, confocal microscopy, pull down, two hybrid colocalization, physical, physical association 9528852 , (Europe PMC )0.40, 0.54 BioGRID, IntAct BARD1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Co-localization, Co-purification, FRET, PCA, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, gal4 vp16 complementation, nuclear magnetic resonance, proximity-dependent biotin identification, pull down, two hybrid association, direct interaction, physical, physical association 10026184 , 10477523 , 10635334 , 11257228 , 11278247 , 11301010 , 11498787 , 11504724 , 11526114 , 11573085 , 11773071 , 11925436 , 11927591 , 12431996 , 12438698 , 12485996 , 12700228 , 12732733 , 12890688 , 12951069 , 14636569 , 14638690 , 14647430 , 15159397 , 15569676 , 15855157 , 16391231 , 16403807 , 16489000 , 17525341 , 17664283 , 17873885 , 18493658 , 18936166 , 19117993 , 19176389 , 19369211 , 19766185 , 19916563 , 20060929 , 20215511 , 20681793 , 21901007 , 22110403 , 23086937 , 23416467 , 23680151 , 24085845 , 24289923 , 24695549 , 25184681 , 25252691 , 25634209 , 25652403 , 25823446 , 26490435 , 26831064 , 27239795 , 28514442 , 28948225 , 29656893 , 8944023 , 9342365 , 9738006 , 9788437 , 9798686 , (Europe PMC )0.95 BioGRID, IntAct, MINT BCL2 Affinity Capture-Western, FRET, confocal microscopy, proximity ligation assay colocalization, physical, physical association 21444675 , (Europe PMC )0.46 BioGRID, IntAct BLM Affinity Capture-MS, Affinity Capture-Western, Co-purification, proximity-dependent biotin identification association, physical 10783165 , 25084169 , 26831064 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct BRAP pull down, two hybrid physical association 9497340 , (Europe PMC )0.51 IntAct BRAT1 Affinity Capture-Western, Co-crystal Structure, Reconstituted Complex, anti bait coimmunoprecipitation, confocal microscopy, pull down, two hybrid colocalization, physical, physical association 16452482 , 24073851 , (Europe PMC )0.60 BioGRID, IntAct BRCA1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, proximity-dependent biotin identification association, physical, physical association 11573086 , 11927591 , 12438698 , 14578343 , 15448696 , 16403807 , 16818604 , 20351172 , 21532592 , 21880590 , 21965653 , 25184681 , 26778126 , 29656893 , 8944023 , 9525870 , (Europe PMC )0.56 BioGRID, IntAct BRCA2 Affinity Capture-MS, Affinity Capture-Western, Co-purification, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, cosedimentation through density gradient, molecular sieving, proximity-dependent biotin identification, tandem affinity purification association, colocalization, physical, physical association 11477095 , 14499622 , 14636569 , 17664283 , 19369211 , 21135251 , 22193777 , 24085845 , 25184681 , 25652403 , 29656893 , 9774970 , (Europe PMC )0.74 BioGRID, IntAct, MINT BRCC3 Affinity Capture-MS, Affinity Capture-Western, Co-purification, anti tag coimmunoprecipitation, proximity-dependent biotin identification association, physical 14636569 , 17664283 , 19202061 , 19305427 , 22990118 , 25184681 , 25252691 , 29656893 , (Europe PMC )0.53 BioGRID, IntAct BRIP1 Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Co-localization, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, molecular sieving, proximity-dependent biotin identification, pull down, surface plasmon resonance, tandem affinity purification association, direct interaction, physical, physical association 11877378 , 14576432 , 14576433 , 14578343 , 15133502 , 15242590 , 17525340 , 17525341 , 17525342 , 17581638 , 17596542 , 18285836 , 18717574 , 19369211 , 19452558 , 20159462 , 20173781 , 20681793 , 21240188 , 22032289 , 23157317 , 23530059 , 24573678 , 25184681 , 26831064 , 27399284 , 29656893 , (Europe PMC )0.94 BioGRID, IntAct, MINT CABIN1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct CCND1 Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, confocal microscopy colocalization, physical, physical association 17334399 , 9244350 , (Europe PMC )0.46 BioGRID, IntAct CCNE1 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 17525332 , (Europe PMC )0.40 BioGRID, IntAct CENPI proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct CENPU proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct CHEK1 Affinity Capture-Western, Biochemical Activity, Negative Genetic, anti bait coimmunoprecipitation, confocal microscopy colocalization, genetic, physical, physical association 11836499 , 17380128 , 28319113 , (Europe PMC )0.46 BioGRID, IntAct CHEK2 Affinity Capture-Western, Biochemical Activity, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 10724175 , 12438214 , 17380128 , 17525332 , 18804494 , 26121674 , (Europe PMC )0.35 BioGRID, IntAct CHMP5 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct CIP2A proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct CPSF6 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct CREB1 Phenotypic Enhancement, pull down direct interaction, genetic 10945975 , 9926942 , (Europe PMC )0.44 BioGRID, IntAct, MINT CSTF2 Affinity Capture-Western, Co-purification, anti bait coimmunoprecipitation association, physical 10477523 , 11257228 , (Europe PMC )0.35 BioGRID, IntAct CT45A3 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct CTBP2 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct CTC1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct DCLRE1A proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct DCLRE1B proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct DDX42 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct DHX38 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct EBI-2694074 pull down association 19505873 , (Europe PMC )0.35 IntAct EBI-4399559 comigration in sds page direct interaction 17873885 , (Europe PMC )0.44 IntAct EGLN3 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct EGR3 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct EME1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct EMSY proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct ENSG00000096717 chromatin immunoprecipitation assay association 21407215 , (Europe PMC )0.35 IntAct ENSG00000124762 chromatin immunoprecipitation assay association 21407215 , (Europe PMC )0.35 IntAct EPM2AIP1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct ERCC1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct ERCC4 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct ESR1 Affinity Capture-Western, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, pull down direct interaction, physical, physical association 11244506 , 11493692 , 11782371 , 12400015 , 15674350 , 16061635 , 16860316 , 17505062 , 19887647 , 20060929 , 25499220 , (Europe PMC )0.76 BioGRID, IntAct, MINT ETAA1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct ETV6 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct EWSR1 Affinity Capture-MS, proximity-dependent biotin identification association, physical 26831064 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct EXD2 anti tag coimmunoprecipitation association 26807646 , (Europe PMC )0.35 IntAct EZH2 anti bait coimmunoprecipitation association 23624935 , (Europe PMC )0.35 IntAct, MINT FAAP100 {ECO:0000303|PubMed:17396147, proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct FAAP24 {ECO:0000303|PubMed:17289582, proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct FAM111A proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct FAM83H proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct FANCA Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, proximity-dependent biotin identification, two hybrid association, physical, physical association 12354784 , 21240188 , 29656893 , (Europe PMC )0.75 BioGRID, IntAct, MINT FANCB proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct FANCC proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct FANCD2 Affinity Capture-Western, Biochemical Activity, Two-hybrid, coimmunoprecipitation, fluorescence microscopy, proximity-dependent biotin identification association, colocalization, physical, physical association 11239454 , 12887909 , 14499622 , 25652403 , 29656893 , (Europe PMC )0.60 BioGRID, IntAct, MINT FANCE proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct FANCF proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct FANCG proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct FANCI proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct FANCL proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct FANCM proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct FHL2 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid physical, physical association 14550570 , 14986435 , 21988832 , 25184681 , (Europe PMC )0.71 BioGRID, IntAct, MINT FOSL2 Affinity Capture-MS, proximity-dependent biotin identification association, physical 25184681 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct FUBP1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct FUS Affinity Capture-MS, proximity-dependent biotin identification association, physical 26831064 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct GFI1B Two-hybrid, two hybrid physical, physical association 16713569 , (Europe PMC )0.37 BioGRID, IntAct GTF2I Affinity Capture-Western, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy, pull down colocalization, physical, physical association 21407215 , (Europe PMC )0.61 BioGRID, IntAct H2AFX Affinity Capture-Western, Biochemical Activity, Co-localization, Reconstituted Complex, coimmunoprecipitation, confocal microscopy, cosedimentation through density gradient, fluorescence microscopy colocalization, physical, physical association 10959836 , 11927591 , 12419185 , 12485996 , 18001824 , 18001825 , 18344987 , 19766185 , 19805520 , 20681793 , 22193777 , 26121674 , (Europe PMC )0.71 BioGRID, IntAct, MINT HIST1H4A anti bait coimmunoprecipitation physical association 16628214 , (Europe PMC )0.40 IntAct, MINT HIVEP1 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct HMBOX1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct HMMR Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation association, physical, physical association 22110403 , 25184681 , 26831064 , (Europe PMC )0.50 BioGRID, IntAct HNRNPA1 Affinity Capture-RNA, proximity-dependent biotin identification association, physical 18391021 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct HNRNPA2B1 Affinity Capture-MS, Affinity Capture-RNA, proximity-dependent biotin identification association, physical 18391021 , 26831064 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct HNRNPAB Affinity Capture-MS, proximity-dependent biotin identification association, physical 26831064 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct HSPD1 Affinity Capture-Western, Two-hybrid, pull down, two hybrid physical, physical association 21988832 , (Europe PMC )0.51 BioGRID, IntAct HUS1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct IFI16 Affinity Capture-Western, Co-localization, anti bait coimmunoprecipitation, confocal microscopy, pull down colocalization, physical, physical association 14654789 , 26121674 , (Europe PMC )0.56 BioGRID, IntAct JAK1 Affinity Capture-Western, coimmunoprecipitation physical, physical association 11163768 , (Europe PMC )0.40 BioGRID, IntAct, MINT JAK2 Affinity Capture-Western, coimmunoprecipitation physical, physical association 11163768 , (Europe PMC )0.40 BioGRID, IntAct, MINT JUN Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 12080089 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT JUP Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct KHSRP Affinity Capture-MS, proximity-dependent biotin identification association, physical 26831064 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct KIF18A proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct KIF20B proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct KIF23 Affinity Capture-MS, proximity-dependent biotin identification association, physical 26831064 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct KIF2A proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct KIF2C proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct KIF4A proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct KIFC1 Affinity Capture-MS, proximity-dependent biotin identification association, physical 26831064 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct KNL1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct KPNA1 two hybrid physical association 8955125 , (Europe PMC )0.37 IntAct, MINT KPNA2 Affinity Capture-MS, Two-hybrid, pull down, two hybrid physical, physical association 25184681 , 26831064 , 8955125 , 9497340 , (Europe PMC )0.51 BioGRID, IntAct LMNA Affinity Capture-MS, cosedimentation through density gradient colocalization, physical 22193777 , 26831064 , (Europe PMC )0.35 BioGRID, IntAct, MINT LONRF1 Two-hybrid, two hybrid array physical, physical association 22493164 , (Europe PMC )0.37 BioGRID, IntAct LUZP1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct MAU2 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct MCPH1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct MDC1 Affinity Capture-Western, Co-localization, anti bait coimmunoprecipitation, imaging technique, proximity-dependent biotin identification association, colocalization, physical, physical association 12607005 , 12611903 , 15569676 , 17525332 , 19766185 , 21622030 , 29656893 , (Europe PMC )0.65 BioGRID, IntAct MED12 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct MLH1 Affinity Capture-MS, Affinity Capture-Western, Co-purification, anti bait coimmunoprecipitation, proximity-dependent biotin identification association, physical 10783165 , 17148452 , 21240188 , 25184681 , 29656893 , (Europe PMC )0.53 BioGRID, IntAct, MINT MMS22L proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct MNAT1 Affinity Capture-Western, Two-hybrid, two hybrid array physical, physical association 15282296 , 22493164 , (Europe PMC )0.37 BioGRID, IntAct MORC3 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct MORF4L1 Affinity Capture-Western, cosedimentation through density gradient colocalization, physical 20332121 , 22193777 , (Europe PMC )0.35 BioGRID, IntAct, MINT MRE11 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct MUS81 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct NBN Affinity Capture-MS, Affinity Capture-Western, Co-localization, Co-purification, proximity-dependent biotin identification association, physical 10426999 , 10783165 , 11504724 , 18171670 , 19244116 , 25184681 , 25659039 , 25939603 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct NCAPD3 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct NCAPG2 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct NCK1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct NELFB Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, confocal microscopy, pull down, two hybrid colocalization, physical, physical association 11739404 , (Europe PMC )0.60 BioGRID, IntAct NFIC proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct NR2F2 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct NSMCE1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct NSMCE2 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct NSMCE3 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct NSMCE4A proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct ORC3 Affinity Capture-Western, anti tag coimmunoprecipitation physical, physical association 17525332 , (Europe PMC )0.40 BioGRID, IntAct PALB2 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, cosedimentation through density gradient, molecular sieving, proximity-dependent biotin identification, pull down, tandem affinity purification association, colocalization, physical, physical association 19268590 , 19369211 , 19553677 , 19584259 , 22193777 , 22331464 , 23038782 , 23585894 , 24085845 , 25016020 , 25184681 , 25652403 , 26649820 , 29656893 , (Europe PMC )0.87 BioGRID, IntAct, MINT PEX5 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct PIAS1 Biochemical Activity, Co-localization, proximity-dependent biotin identification association, physical 20016594 , 20016603 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct PIK3R1 Reconstituted Complex, peptide array physical, physical association 16135792 , 17474147 , (Europe PMC )0.40 BioGRID, IntAct PLK1 Affinity Capture-Western, proximity-dependent biotin identification association, physical 24067368 , 25483079 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct PML proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct PMS2P3 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct POLD1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct POLE proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct POMGNT1 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct POT1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct PPP1CA Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 12438214 , 17511879 , 22990118 , 25056273 , (Europe PMC )0.52 BioGRID, IntAct PPP1CB Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, two hybrid physical, physical association 17511879 , (Europe PMC )0.58 BioGRID, IntAct PPP1CC anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical association 17511879 , (Europe PMC )0.52 IntAct PRAME proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct PRC1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RAD1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RAD18 Affinity Capture-MS, Affinity Capture-Western, proximity-dependent biotin identification association, physical 23901102 , 25184681 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct RAD23B Affinity Capture-MS, pull down physical, physical association 16712842 , (Europe PMC )0.40 BioGRID, IntAct, MINT RAD50 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Co-purification, Reconstituted Complex, Two-hybrid, proximity-dependent biotin identification association, physical 10426999 , 10783165 , 11504724 , 16391231 , 18171670 , 25084169 , 25184681 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct RAD51 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Co-purification, Reconstituted Complex, cosedimentation through density gradient, molecular sieving, proximity-dependent biotin identification association, colocalization, physical, physical association 11498787 , 14636569 , 19369211 , 19766185 , 22193777 , 24085845 , 25499220 , 25659039 , 29656893 , 9008167 , 9774970 , (Europe PMC )0.67 BioGRID, IntAct, MINT RAD51B proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RAD52 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RAD54L2 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RAD9A proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RBBP8 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-localization, Protein-peptide, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, molecular sieving, proximity-dependent biotin identification, pull down, tandem affinity purification, two hybrid association, physical, physical association 10196224 , 10764811 , 10910365 , 11689934 , 11739404 , 14578343 , 16818604 , 16843262 , 17525340 , 17525342 , 18171670 , 18285836 , 19369211 , 19452558 , 20351172 , 21908405 , 23416467 , 24085845 , 25184681 , 25252691 , 25310973 , 25659039 , 26387952 , 26446986 , 29656893 , 9738006 , 9811458 , (Europe PMC )0.87 BioGRID, IntAct RBM45 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RECQL proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RECQL4 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RECQL5 Affinity Capture-MS, proximity-dependent biotin identification association, physical 22990118 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct RHNO1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RIF1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RMI1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RMI2 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RNF168 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RNF169 Affinity Capture-MS, proximity-dependent biotin identification association, physical 25184681 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct RNF6 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RNF8 fluorescence microscopy colocalization 18001825 , (Europe PMC )0.27 IntAct RPA1 Affinity Capture-Western, Co-localization, anti bait coimmunoprecipitation, molecular sieving, proximity-dependent biotin identification association, physical, physical association 19369211 , 19766185 , 21240188 , 23901102 , 29656893 , (Europe PMC )0.67 BioGRID, IntAct, MINT RPA2 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RPA3 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RPL13 two hybrid physical association 16452482 , (Europe PMC )0.37 IntAct SAGE1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct SETX proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct SGO2 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct SLF1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct SLF2 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct SLX4 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct SLX4IP proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct SMC1A Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 11877377 , 25184681 , 26831064 , (Europe PMC )0.40 BioGRID, IntAct SMC5 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct SMC6 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct SMCHD1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct SMTN proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct STAG1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct STN1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct SUMO1 Affinity Capture-MS, Affinity Capture-Western, FRET, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, fluorescent resonance energy transfer, pull down direct interaction, physical, physical association 18025037 , 20016594 , 26831064 , (Europe PMC )0.60 BioGRID, IntAct SUMO2 anti tag coimmunoprecipitation, pull down physical association 20016594 , 20016603 , (Europe PMC )0.59 IntAct SUZ12 Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 23624935 , (Europe PMC )0.35 BioGRID, IntAct, MINT TERF1 Affinity Capture-Western, proximity-dependent biotin identification association, physical 19797051 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct TERF2 Affinity Capture-MS, Affinity Capture-Western, proximity-dependent biotin identification association, physical 19797051 , 25184681 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct TERF2IP proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct TINF2 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct TONSL Affinity Capture-MS, Affinity Capture-Western, Co-localization, Synthetic Growth Defect, proximity-dependent biotin identification association, genetic, physical 25184681 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct TOP2A Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, pull down physical, physical association 15965487 , 25184681 , (Europe PMC )0.52 BioGRID, IntAct TOP3A proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct TOPBP1 Affinity Capture-MS, Affinity Capture-Western, Co-localization, proximity-dependent biotin identification association, physical 16391231 , 19766185 , 23157317 , 23901102 , 25184681 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct TP53 Affinity Capture-MS, Affinity Capture-Western, Co-purification, Reconstituted Complex, coimmunoprecipitation, pull down direct interaction, physical, physical association 14636569 , 14710355 , 15571721 , 16677609 , 16969499 , 19509300 , 21742769 , 26140185 , 9482880 , 9582019 , 9926942 , (Europe PMC )0.54 BioGRID, IntAct, MINT TP53BP1 anti bait coimmunoprecipitation, confocal microscopy, proximity-dependent biotin identification association, colocalization, physical association 17525332 , 18001824 , 22884692 , 29656893 , (Europe PMC )0.71 IntAct TPX2 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, proximity-dependent biotin identification association, physical 22110403 , 25184681 , 29656893 , (Europe PMC )0.53 BioGRID, IntAct TRIM24 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct TRIM27 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct TRIM28 Affinity Capture-MS, proximity-dependent biotin identification association, physical 26831064 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct TRIM33 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct TRIM46 Two-hybrid, two hybrid array physical, physical association 22493164 , (Europe PMC )0.37 BioGRID, IntAct TRIM74 Two-hybrid, two hybrid array physical, physical association 22493164 , (Europe PMC )0.37 BioGRID, IntAct UBE2J1 Two-hybrid, two hybrid array physical, physical association 19690564 , (Europe PMC )0.37 BioGRID, IntAct UIMC1 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation, fluorescence microscopy, proximity-dependent biotin identification, pull down, tandem affinity purification association, colocalization, direct interaction, physical, physical association 17525340 , 17525341 , 17525342 , 17621610 , 17643121 , 19261748 , 19305427 , 19615732 , 19766185 , 21622030 , 24085845 , 25184681 , 25252691 , 26446986 , 28569838 , 29656893 , (Europe PMC )0.40, 0.72 BioGRID, IntAct VCAM1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct WRN proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct WRNIP1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct ZBTB1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct ZBTB48 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct ZCCHC8 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 17525332 , (Europe PMC )0.52 BioGRID, IntAct ZHX1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct ZNF207 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct ZNF350 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, coimmunoprecipitation, pull down, two hybrid physical, physical association 11090615 , 16843262 , 23991171 , (Europe PMC )0.58 BioGRID, IntAct ZNF827 Co-localization, proximity-dependent biotin identification association, physical 25150861 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source BARD1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Co-localization, Co-purification, FRET, PCA, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, gal4 vp16 complementation, nuclear magnetic resonance, proximity-dependent biotin identification, pull down, two hybrid association, direct interaction, physical, physical association 10026184 , 10477523 , 10635334 , 11257228 , 11278247 , 11301010 , 11498787 , 11504724 , 11526114 , 11573085 , 11773071 , 11925436 , 11927591 , 12431996 , 12438698 , 12485996 , 12700228 , 12732733 , 12890688 , 12951069 , 14636569 , 14638690 , 14647430 , 15159397 , 15569676 , 15855157 , 16391231 , 16403807 , 16489000 , 17525341 , 17664283 , 17873885 , 18493658 , 18936166 , 19117993 , 19176389 , 19369211 , 19766185 , 19916563 , 20060929 , 20215511 , 20681793 , 21901007 , 22110403 , 23086937 , 23416467 , 23680151 , 24085845 , 24289923 , 24695549 , 25184681 , 25252691 , 25634209 , 25652403 , 25823446 , 26490435 , 26831064 , 27239795 , 28514442 , 28948225 , 29656893 , 8944023 , 9342365 , 9738006 , 9788437 , 9798686 , (Europe PMC )0.95 BioGRID, IntAct, MINT BRCA2 Affinity Capture-MS, Affinity Capture-Western, Co-purification, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, cosedimentation through density gradient, molecular sieving, proximity-dependent biotin identification, tandem affinity purification association, colocalization, physical, physical association 11477095 , 14499622 , 14636569 , 17664283 , 19369211 , 21135251 , 22193777 , 24085845 , 25184681 , 25652403 , 29656893 , 9774970 , (Europe PMC )0.74 BioGRID, IntAct, MINT BRIP1 Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Co-localization, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, molecular sieving, proximity-dependent biotin identification, pull down, surface plasmon resonance, tandem affinity purification association, direct interaction, physical, physical association 11877378 , 14576432 , 14576433 , 14578343 , 15133502 , 15242590 , 17525340 , 17525341 , 17525342 , 17581638 , 17596542 , 18285836 , 18717574 , 19369211 , 19452558 , 20159462 , 20173781 , 20681793 , 21240188 , 22032289 , 23157317 , 23530059 , 24573678 , 25184681 , 26831064 , 27399284 , 29656893 , (Europe PMC )0.94 BioGRID, IntAct, MINT CREB1 Phenotypic Enhancement, pull down direct interaction, genetic 10945975 , 9926942 , (Europe PMC )0.44 BioGRID, IntAct, MINT ESR1 Affinity Capture-Western, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, pull down direct interaction, physical, physical association 11244506 , 11493692 , 11782371 , 12400015 , 15674350 , 16061635 , 16860316 , 17505062 , 19887647 , 20060929 , 25499220 , (Europe PMC )0.76 BioGRID, IntAct, MINT EZH2 anti bait coimmunoprecipitation association 23624935 , (Europe PMC )0.35 IntAct, MINT FANCA Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, proximity-dependent biotin identification, two hybrid association, physical, physical association 12354784 , 21240188 , 29656893 , (Europe PMC )0.75 BioGRID, IntAct, MINT FANCD2 Affinity Capture-Western, Biochemical Activity, Two-hybrid, coimmunoprecipitation, fluorescence microscopy, proximity-dependent biotin identification association, colocalization, physical, physical association 11239454 , 12887909 , 14499622 , 25652403 , 29656893 , (Europe PMC )0.60 BioGRID, IntAct, MINT FHL2 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid physical, physical association 14550570 , 14986435 , 21988832 , 25184681 , (Europe PMC )0.71 BioGRID, IntAct, MINT H2AFX Affinity Capture-Western, Biochemical Activity, Co-localization, Reconstituted Complex, coimmunoprecipitation, confocal microscopy, cosedimentation through density gradient, fluorescence microscopy colocalization, physical, physical association 10959836 , 11927591 , 12419185 , 12485996 , 18001824 , 18001825 , 18344987 , 19766185 , 19805520 , 20681793 , 22193777 , 26121674 , (Europe PMC )0.71 BioGRID, IntAct, MINT HIST1H4A anti bait coimmunoprecipitation physical association 16628214 , (Europe PMC )0.40 IntAct, MINT JAK1 Affinity Capture-Western, coimmunoprecipitation physical, physical association 11163768 , (Europe PMC )0.40 BioGRID, IntAct, MINT JAK2 Affinity Capture-Western, coimmunoprecipitation physical, physical association 11163768 , (Europe PMC )0.40 BioGRID, IntAct, MINT JUN Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 12080089 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT KPNA1 two hybrid physical association 8955125 , (Europe PMC )0.37 IntAct, MINT LMNA Affinity Capture-MS, cosedimentation through density gradient colocalization, physical 22193777 , 26831064 , (Europe PMC )0.35 BioGRID, IntAct, MINT MLH1 Affinity Capture-MS, Affinity Capture-Western, Co-purification, anti bait coimmunoprecipitation, proximity-dependent biotin identification association, physical 10783165 , 17148452 , 21240188 , 25184681 , 29656893 , (Europe PMC )0.53 BioGRID, IntAct, MINT MORF4L1 Affinity Capture-Western, cosedimentation through density gradient colocalization, physical 20332121 , 22193777 , (Europe PMC )0.35 BioGRID, IntAct, MINT PALB2 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, cosedimentation through density gradient, molecular sieving, proximity-dependent biotin identification, pull down, tandem affinity purification association, colocalization, physical, physical association 19268590 , 19369211 , 19553677 , 19584259 , 22193777 , 22331464 , 23038782 , 23585894 , 24085845 , 25016020 , 25184681 , 25652403 , 26649820 , 29656893 , (Europe PMC )0.87 BioGRID, IntAct, MINT RAD23B Affinity Capture-MS, pull down physical, physical association 16712842 , (Europe PMC )0.40 BioGRID, IntAct, MINT RAD51 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Co-purification, Reconstituted Complex, cosedimentation through density gradient, molecular sieving, proximity-dependent biotin identification association, colocalization, physical, physical association 11498787 , 14636569 , 19369211 , 19766185 , 22193777 , 24085845 , 25499220 , 25659039 , 29656893 , 9008167 , 9774970 , (Europe PMC )0.67 BioGRID, IntAct, MINT RPA1 Affinity Capture-Western, Co-localization, anti bait coimmunoprecipitation, molecular sieving, proximity-dependent biotin identification association, physical, physical association 19369211 , 19766185 , 21240188 , 23901102 , 29656893 , (Europe PMC )0.67 BioGRID, IntAct, MINT SUZ12 Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 23624935 , (Europe PMC )0.35 BioGRID, IntAct, MINT TP53 Affinity Capture-MS, Affinity Capture-Western, Co-purification, Reconstituted Complex, coimmunoprecipitation, pull down direct interaction, physical, physical association 14636569 , 14710355 , 15571721 , 16677609 , 16969499 , 19509300 , 21742769 , 26140185 , 9482880 , 9582019 , 9926942 , (Europe PMC )0.54 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AARS Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ABCF2 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID ABL1 Affinity Capture-Western, Biochemical Activity, FRET, Reconstituted Complex, bimolecular fluorescence complementation physical, physical association 12024016 , 17352427 , (Europe PMC )0.37 BioGRID, IntAct, MINT ABLIM3 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID ABRAXAS1 Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Co-localization, Protein-peptide, Reconstituted Complex physical 17525340 , 17643121 , 17643122 , 19261746 , 19261748 , 19261749 , 19305427 , 19766185 , 21282113 , 22357538 , 23416467 , 25184681 , 26778126 , (Europe PMC )NA BioGRID ABRAXAS1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy, proximity-dependent biotin identification, pull down, surface plasmon resonance association, colocalization, direct interaction, physical association 17525340 , 17643121 , 29656893 , (Europe PMC )0.82 IntAct ACACA Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, pull down physical, physical association 12360400 , 16326698 , 16698035 , 18452305 , 19061860 , 24565757 , (Europe PMC )0.52 BioGRID, IntAct ACD proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct ACLY Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ACTG1 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID ACTN3 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID ADRM1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID AFAP1 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID AGL Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID AGO2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID AGO3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID AHCY Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID AHNAK Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID AHR Affinity Capture-Western, Reconstituted Complex physical 18259752 , (Europe PMC )NA BioGRID AIMP1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID AIMP2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID AKAP12 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID AKAP8 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID AKT1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, pull down physical, physical association 10542266 , 19074868 , 21242970 , (Europe PMC )0.40 BioGRID, IntAct ALDH9A1 Affinity Capture-Western, Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID ALDOA Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ALMS1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ANKRD26 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID ANKRD28 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex physical 22990118 , 27026398 , (Europe PMC )NA BioGRID ANKRD44 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID ANLN proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct ANXA1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ANXA5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID AP1M1 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID AP2A1 Affinity Capture-Western physical 21880590 , (Europe PMC )NA BioGRID AP2B1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID APEH Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID APEX1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID APLP2 Far Western physical 11746496 , (Europe PMC )NA BioGRID AR Reconstituted Complex, Two-hybrid physical 11016951 , 11085509 , (Europe PMC )NA BioGRID ARFGEF1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ARFGEF2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ARID1A proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct ARIH1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ARNT Affinity Capture-Western, Reconstituted Complex physical 16567799 , (Europe PMC )NA BioGRID ASH2L Affinity Capture-MS, Two-hybrid physical 22990118 , 26831064 , (Europe PMC )NA BioGRID ATF1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 10945975 , (Europe PMC )NA BioGRID ATM Affinity Capture-Western, Biochemical Activity, Co-purification, Protein-peptide, Reconstituted Complex, proximity-dependent biotin identification association, physical 10550055 , 10608806 , 10783165 , 10866324 , 11114888 , 17478428 , 18344987 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct ATP1B1 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID ATP1B3 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID ATR Affinity Capture-Western, Biochemical Activity, Protein-peptide, Reconstituted Complex, proximity-dependent biotin identification association, physical 10608806 , 11016625 , 11114888 , 11278964 , 17478428 , 23901102 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct ATRIP Affinity Capture-Western, Co-crystal Structure, Reconstituted Complex, proximity-dependent biotin identification association, physical 17616665 , 24073851 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct ATXN2L Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID AURKA Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 14990569 , 22110403 , 26831064 , (Europe PMC )0.35 BioGRID, IntAct AURKC Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID BABAM1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, proximity-dependent biotin identification association, physical 19261746 , 19261749 , 22792303 , 25184681 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct BABAM2 Affinity Capture-MS, Affinity Capture-Western, Co-purification physical 14636569 , 22990118 , 25184681 , (Europe PMC )NA BioGRID BABAM2 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct BACH1 Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Protein-peptide, Reconstituted Complex physical 11301010 , 15125843 , 15242590 , 16391231 , 17525340 , 17664283 , 19369211 , 25252691 , (Europe PMC )NA BioGRID BAP1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, confocal microscopy, pull down, two hybrid colocalization, physical, physical association 9528852 , (Europe PMC )0.40, 0.54 BioGRID, IntAct BARD1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Co-localization, Co-purification, FRET, PCA, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, gal4 vp16 complementation, nuclear magnetic resonance, proximity-dependent biotin identification, pull down, two hybrid association, direct interaction, physical, physical association 10026184 , 10477523 , 10635334 , 11257228 , 11278247 , 11301010 , 11498787 , 11504724 , 11526114 , 11573085 , 11773071 , 11925436 , 11927591 , 12431996 , 12438698 , 12485996 , 12700228 , 12732733 , 12890688 , 12951069 , 14636569 , 14638690 , 14647430 , 15159397 , 15569676 , 15855157 , 16391231 , 16403807 , 16489000 , 17525341 , 17664283 , 17873885 , 18493658 , 18936166 , 19117993 , 19176389 , 19369211 , 19766185 , 19916563 , 20060929 , 20215511 , 20681793 , 21901007 , 22110403 , 23086937 , 23416467 , 23680151 , 24085845 , 24289923 , 24695549 , 25184681 , 25252691 , 25634209 , 25652403 , 25823446 , 26490435 , 26831064 , 27239795 , 28514442 , 28948225 , 29656893 , 8944023 , 9342365 , 9738006 , 9788437 , 9798686 , (Europe PMC )0.95 BioGRID, IntAct, MINT BCL2 Affinity Capture-Western, FRET, confocal microscopy, proximity ligation assay colocalization, physical, physical association 21444675 , (Europe PMC )0.46 BioGRID, IntAct BECN1 Affinity Capture-Western physical 24378767 , (Europe PMC )NA BioGRID BLM Affinity Capture-MS, Affinity Capture-Western, Co-purification, proximity-dependent biotin identification association, physical 10783165 , 25084169 , 26831064 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct BORA Affinity Capture-MS, Affinity Capture-Western physical 22990118 , 24067368 , (Europe PMC )NA BioGRID BPTF Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID BRAP Reconstituted Complex, Two-hybrid physical 8955125 , 9497340 , (Europe PMC )NA BioGRID BRAP pull down, two hybrid physical association 9497340 , (Europe PMC )0.51 IntAct BRAT1 Affinity Capture-Western, Co-crystal Structure, Reconstituted Complex, anti bait coimmunoprecipitation, confocal microscopy, pull down, two hybrid colocalization, physical, physical association 16452482 , 24073851 , (Europe PMC )0.60 BioGRID, IntAct BRCA1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, proximity-dependent biotin identification association, physical, physical association 11573086 , 11927591 , 12438698 , 14578343 , 15448696 , 16403807 , 16818604 , 20351172 , 21532592 , 21880590 , 21965653 , 25184681 , 26778126 , 29656893 , 8944023 , 9525870 , (Europe PMC )0.56 BioGRID, IntAct BRCA2 Affinity Capture-MS, Affinity Capture-Western, Co-purification, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, cosedimentation through density gradient, molecular sieving, proximity-dependent biotin identification, tandem affinity purification association, colocalization, physical, physical association 11477095 , 14499622 , 14636569 , 17664283 , 19369211 , 21135251 , 22193777 , 24085845 , 25184681 , 25652403 , 29656893 , 9774970 , (Europe PMC )0.74 BioGRID, IntAct, MINT BRCC3 Affinity Capture-MS, Affinity Capture-Western, Co-purification, anti tag coimmunoprecipitation, proximity-dependent biotin identification association, physical 14636569 , 17664283 , 19202061 , 19305427 , 22990118 , 25184681 , 25252691 , 29656893 , (Europe PMC )0.53 BioGRID, IntAct BRD4 Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID BRD7 Affinity Capture-Western, Co-localization, Two-hybrid physical 20215511 , (Europe PMC )NA BioGRID BRIP1 Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Co-localization, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, molecular sieving, proximity-dependent biotin identification, pull down, surface plasmon resonance, tandem affinity purification association, direct interaction, physical, physical association 11877378 , 14576432 , 14576433 , 14578343 , 15133502 , 15242590 , 17525340 , 17525341 , 17525342 , 17581638 , 17596542 , 18285836 , 18717574 , 19369211 , 19452558 , 20159462 , 20173781 , 20681793 , 21240188 , 22032289 , 23157317 , 23530059 , 24573678 , 25184681 , 26831064 , 27399284 , 29656893 , (Europe PMC )0.94 BioGRID, IntAct, MINT BRSK1 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID BUB3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID C2CD6 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID CABIN1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct CABYR Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID CAD Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CAMK2D Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CAND1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CAP1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CAPRIN1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CAPZA1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CAPZB Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID CARM1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CASP1 Affinity Capture-Western, Co-localization physical 26121674 , (Europe PMC )NA BioGRID CASP9 Affinity Capture-Western physical 16322207 , (Europe PMC )NA BioGRID CBX1 Reconstituted Complex physical 25634209 , (Europe PMC )NA BioGRID CBX3 Affinity Capture-MS, Reconstituted Complex physical 25184681 , 25634209 , (Europe PMC )NA BioGRID CBX5 Reconstituted Complex physical 25634209 , (Europe PMC )NA BioGRID CCAR2 Affinity Capture-MS, Affinity Capture-Western physical 20160719 , 26831064 , (Europe PMC )NA BioGRID CCDC120 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID CCNA2 Affinity Capture-Western, Reconstituted Complex physical 10373534 , 9244350 , (Europe PMC )NA BioGRID CCNB1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 23246971 , 9244350 , (Europe PMC )NA BioGRID CCND1 Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, confocal microscopy colocalization, physical, physical association 17334399 , 9244350 , (Europe PMC )0.46 BioGRID, IntAct CCNE1 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 17525332 , (Europe PMC )0.40 BioGRID, IntAct CCNH Affinity Capture-Western physical 15282296 , (Europe PMC )NA BioGRID CCT2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CCT3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CCT4 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CCT5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CCT6A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CCT7 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CCT8 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CDC16 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID CDC25C Biochemical Activity physical 23246971 , (Europe PMC )NA BioGRID CDC37 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CDC5L Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CDCA2 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID CDH1 Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID CDK1 Reconstituted Complex physical 9244350 , (Europe PMC )NA BioGRID CDK16 Affinity Capture-MS, Two-hybrid physical 22990118 , 25184681 , 26186194 , 9738006 , (Europe PMC )NA BioGRID CDK2 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 10373534 , 8764100 , 9244350 , (Europe PMC )NA BioGRID CDK4 Biochemical Activity, Reconstituted Complex physical 12509456 , 17334399 , 9244350 , (Europe PMC )NA BioGRID CDK7 Affinity Capture-Western physical 15282296 , (Europe PMC )NA BioGRID CDK8 Co-purification physical 9159119 , (Europe PMC )NA BioGRID CDK9 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID CDKN2A Affinity Capture-Western, Co-localization physical 18703154 , (Europe PMC )NA BioGRID CDKN2AIP Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID CDKN2D Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 17334399 , (Europe PMC )NA BioGRID CEBPB Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID CENPB Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID CENPF Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CENPI proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct CENPU proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct CEP350 Affinity Capture-MS, Affinity Capture-Western physical 22990118 , (Europe PMC )NA BioGRID CEP57L1 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID CEP72 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CETN1 Co-localization physical 22833046 , (Europe PMC )NA BioGRID CHD9 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CHEK1 Affinity Capture-Western, Biochemical Activity, Negative Genetic, anti bait coimmunoprecipitation, confocal microscopy colocalization, genetic, physical, physical association 11836499 , 17380128 , 28319113 , (Europe PMC )0.46 BioGRID, IntAct CHEK2 Affinity Capture-Western, Biochemical Activity, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 10724175 , 12438214 , 17380128 , 17525332 , 18804494 , 26121674 , (Europe PMC )0.35 BioGRID, IntAct CHMP5 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct CIP2A proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct CKAP5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CLIC1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CLIP1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CLK2 Affinity Capture-Western, Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID CLSPN Affinity Capture-Western, Biochemical Activity physical 15096610 , 22863316 , (Europe PMC )NA BioGRID CLTC Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CMAS Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID CNN2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CNOT1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CNRIP1 Affinity Capture-Western, Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID CNTLN Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID CNTN4 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID COL1A1 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID COMMD1 Affinity Capture-Western, Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID COPA Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID COPB1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID COPB2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID COPE Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID COPG1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CPOX Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CPSF6 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct CRBN Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CREB1 Phenotypic Enhancement, pull down direct interaction, genetic 10945975 , 9926942 , (Europe PMC )0.44 BioGRID, IntAct, MINT CREB5 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID CREBBP Affinity Capture-Western, Phenotypic Suppression, Reconstituted Complex genetic, physical 10655477 , 11782371 , 12700228 , 16417649 , 16860316 , 9443979 , 9926942 , (Europe PMC )NA BioGRID CRIPAK Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID CRY2 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID CRYZL1 Affinity Capture-Western, Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID CSDE1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CSE1L Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CSNK1D Affinity Capture-MS, Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID CSNK2A1 Reconstituted Complex physical 10403822 , (Europe PMC )NA BioGRID CSNK2B Reconstituted Complex, Two-hybrid physical 10403822 , (Europe PMC )NA BioGRID CSTF1 Reconstituted Complex physical 11257228 , (Europe PMC )NA BioGRID CSTF2 Affinity Capture-Western, Co-purification, anti bait coimmunoprecipitation association, physical 10477523 , 11257228 , (Europe PMC )0.35 BioGRID, IntAct CT45A3 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct CTBP1 Affinity Capture-Western physical 10196224 , (Europe PMC )NA BioGRID CTBP2 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct CTC1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct CTCFL Protein-peptide physical 14578343 , (Europe PMC )NA BioGRID CTNNA1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CTNNB1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 20215423 , 26831064 , (Europe PMC )NA BioGRID CTPS1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CUBN Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID CUL2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CWF19L2 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID DALRD3 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID DARS Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DAZAP1 Affinity Capture-RNA physical 18391021 , (Europe PMC )NA BioGRID DBF4 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID DCAF7 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DCLRE1A proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct DCLRE1B proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct DCLRE1C Affinity Capture-Western physical 15456891 , (Europe PMC )NA BioGRID DCN Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID DCTN1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DDB1 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID DDX1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DDX17 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DDX21 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DDX23 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID DDX24 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID DDX39A Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID DDX42 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct DDX5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DDX54 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID DDX6 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DES Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID DHPS Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID DHX15 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DHX38 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct DHX9 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 12592385 , 26831064 , 9662397 , (Europe PMC )NA BioGRID DIAPH1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DIMT1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DNAJA1 Affinity Capture-MS, Two-hybrid physical 22990118 , 25184681 , 26831064 , (Europe PMC )NA BioGRID DNAJA2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DNAJA3 Protein-peptide physical 14578343 , (Europe PMC )NA BioGRID DNAJA4 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DNAJB1 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID DNAJC10 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DNHD1 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID DNMT1 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID DPY30 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DRG1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID DSP Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DYNC1H1 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID DYNC1I2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID DYRK1A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID E2F1 Affinity Capture-Western physical 21880590 , (Europe PMC )NA BioGRID E2F4 Reconstituted Complex physical 9244350 , (Europe PMC )NA BioGRID EBI-2694074 pull down association 19505873 , (Europe PMC )0.35 IntAct EBI-4399559 comigration in sds page direct interaction 17873885 , (Europe PMC )0.44 IntAct EBNA1BP2 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID ECPAS Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EED Reconstituted Complex physical 23624935 , (Europe PMC )NA BioGRID EEF1B2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EEF1D Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EEF1G Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EEF2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EFTUD2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EGLN3 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct EGR3 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct EIF2S1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EIF3A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EIF3B Affinity Capture-MS, Two-hybrid physical 22990118 , 26831064 , (Europe PMC )NA BioGRID EIF3E Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EIF3G Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EIF3H Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EIF3I Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EIF3L Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EIF3M Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EIF4A2 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID EIF4G1 Affinity Capture-MS, Co-fractionation physical 23805307 , 26831064 , (Europe PMC )NA BioGRID EIF5B Affinity Capture-MS, Two-hybrid physical 22990118 , 26831064 , (Europe PMC )NA BioGRID ELK4 Affinity Capture-Western, Reconstituted Complex physical 11313879 , (Europe PMC )NA BioGRID ELOA Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID EME1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct EMSY proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct ENO1 Affinity Capture-MS, Two-hybrid physical 22990118 , 26831064 , (Europe PMC )NA BioGRID ENSG00000096717 chromatin immunoprecipitation assay association 21407215 , (Europe PMC )0.35 IntAct ENSG00000124762 chromatin immunoprecipitation assay association 21407215 , (Europe PMC )0.35 IntAct EP300 Affinity Capture-Western, Phenotypic Suppression, Reconstituted Complex genetic, physical 10655477 , 11782371 , 19887647 , 21212407 , 22787115 , (Europe PMC )NA BioGRID EPM2AIP1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct EPRS Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ERC1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ERCC1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct ERCC4 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct ERCC5 Affinity Capture-Western, Reconstituted Complex physical 26833090 , (Europe PMC )NA BioGRID ERCC6 Affinity Capture-Western, Biochemical Activity physical 21756275 , (Europe PMC )NA BioGRID ERO1B Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID ESR1 Affinity Capture-Western, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, pull down direct interaction, physical, physical association 11244506 , 11493692 , 11782371 , 12400015 , 15674350 , 16061635 , 16860316 , 17505062 , 19887647 , 20060929 , 25499220 , (Europe PMC )0.76 BioGRID, IntAct, MINT ETAA1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct ETS1 Reconstituted Complex physical 11313879 , (Europe PMC )NA BioGRID ETV5 FRET physical 21282464 , (Europe PMC )NA BioGRID ETV6 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct EWSR1 Affinity Capture-MS, proximity-dependent biotin identification association, physical 26831064 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct EXD2 Affinity Capture-Western physical 26807646 , (Europe PMC )NA BioGRID EXD2 anti tag coimmunoprecipitation association 26807646 , (Europe PMC )0.35 IntAct EXOSC10 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EXOSC8 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID EZH2 Affinity Capture-Western, Reconstituted Complex physical 23624935 , 25531315 , (Europe PMC )NA BioGRID EZH2 anti bait coimmunoprecipitation association 23624935 , (Europe PMC )0.35 IntAct, MINT EZR Affinity Capture-MS, Affinity Capture-Western physical 21282464 , 26831064 , (Europe PMC )NA BioGRID FAAP100 {ECO:0000303|PubMed:17396147, proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct FAAP24 {ECO:0000303|PubMed:17289582, proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct FAM111A proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct FAM120A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID FAM161A Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID FAM184A Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID FAM83A Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID FAM83H proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct FAM98A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID FANCA Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, proximity-dependent biotin identification, two hybrid association, physical, physical association 12354784 , 21240188 , 29656893 , (Europe PMC )0.75 BioGRID, IntAct, MINT FANCB proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct FANCC proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct FANCD2 Affinity Capture-Western, Biochemical Activity, Two-hybrid, coimmunoprecipitation, fluorescence microscopy, proximity-dependent biotin identification association, colocalization, physical, physical association 11239454 , 12887909 , 14499622 , 25652403 , 29656893 , (Europe PMC )0.60 BioGRID, IntAct, MINT FANCE proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct FANCF proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct FANCG proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct FANCI proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct FANCL proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct FANCM proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct FASN Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID FAU Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID FBL Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID FBXO44 Affinity Capture-Western, Biochemical Activity physical 23086937 , (Europe PMC )NA BioGRID FBXO5 Affinity Capture-Western physical 23086937 , (Europe PMC )NA BioGRID FGFR1OP Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID FHL2 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid physical, physical association 14550570 , 14986435 , 21988832 , 25184681 , (Europe PMC )0.71 BioGRID, IntAct, MINT FKBP4 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID FLI1 Reconstituted Complex physical 11313879 , (Europe PMC )NA BioGRID FLII Affinity Capture-MS, Affinity Capture-Western physical 22990118 , 26831064 , (Europe PMC )NA BioGRID FLNA Affinity Capture-MS physical 22990118 , 26831064 , (Europe PMC )NA BioGRID FLNB Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID FLNC Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID FLT3 Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID FLYWCH1 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID FN3KRP Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID FNTA Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID FOSL2 Affinity Capture-MS, proximity-dependent biotin identification association, physical 25184681 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct FOXO3 Affinity Capture-Western physical 18344987 , (Europe PMC )NA BioGRID FUBP1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct FUS Affinity Capture-MS, proximity-dependent biotin identification association, physical 26831064 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct FXR2 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID GANAB Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID GAPDH Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID GAR1 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID GARS Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID GART Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID GATA3 Affinity Capture-Western physical 22120723 , (Europe PMC )NA BioGRID GATAD2B Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID GCC1 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID GCN1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID GEMIN5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID GFI1B Two-hybrid, two hybrid physical, physical association 16713569 , (Europe PMC )0.37 BioGRID, IntAct GGN Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID GIPC1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID GMPS Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID GNL3L Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID GOLGA5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID GOLGA8DP Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID GPI Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID GPN1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID GPN3 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID GPR161 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID GRN Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID GRPEL1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID GTF2E1 Co-purification physical 9159119 , (Europe PMC )NA BioGRID GTF2F1 Co-purification physical 9159119 , (Europe PMC )NA BioGRID GTF2H4 Co-purification physical 9159119 , (Europe PMC )NA BioGRID GTF2I Affinity Capture-Western, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy, pull down colocalization, physical, physical association 21407215 , (Europe PMC )0.61 BioGRID, IntAct GTF2IRD1 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID GTF3C4 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID GTF3C6 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID GUSBP1 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID H2AFX Affinity Capture-Western, Biochemical Activity, Co-localization, Reconstituted Complex, coimmunoprecipitation, confocal microscopy, cosedimentation through density gradient, fluorescence microscopy colocalization, physical, physical association 10959836 , 11927591 , 12419185 , 12485996 , 18001824 , 18001825 , 18344987 , 19766185 , 19805520 , 20681793 , 22193777 , 26121674 , (Europe PMC )0.71 BioGRID, IntAct, MINT H2AFY Co-localization physical 12419249 , (Europe PMC )NA BioGRID HCFC1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HDAC1 Reconstituted Complex physical 10220405 , (Europe PMC )NA BioGRID HDAC2 Affinity Capture-Western, Negative Genetic, Reconstituted Complex genetic, physical 10220405 , 21946536 , 28319113 , (Europe PMC )NA BioGRID HECTD3 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID HERC1 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID HERC2 Affinity Capture-Western, Biochemical Activity physical 20631078 , 25480944 , (Europe PMC )NA BioGRID HGF Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID HIBADH Affinity Capture-Western, Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID HIF1A Affinity Capture-Western physical 16543242 , (Europe PMC )NA BioGRID HIST1H2AB Biochemical Activity physical 25131202 , 25355358 , (Europe PMC )NA BioGRID HIST1H2BG Proximity Label-MS physical 25281560 , (Europe PMC )NA BioGRID HIST1H4A anti bait coimmunoprecipitation physical association 16628214 , (Europe PMC )0.40 IntAct, MINT HIST2H2AC Biochemical Activity physical 11927591 , 19916563 , (Europe PMC )NA BioGRID HIST2H3C Co-localization physical 12419249 , (Europe PMC )NA BioGRID HIVEP1 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct HLTF Affinity Capture-Western physical 23901102 , (Europe PMC )NA BioGRID HMBOX1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct HMMR Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation association, physical, physical association 22110403 , 25184681 , 26831064 , (Europe PMC )0.50 BioGRID, IntAct HNRNPA0 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HNRNPA1 Affinity Capture-RNA, proximity-dependent biotin identification association, physical 18391021 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct HNRNPA2B1 Affinity Capture-MS, Affinity Capture-RNA, proximity-dependent biotin identification association, physical 18391021 , 26831064 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct HNRNPA3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HNRNPAB Affinity Capture-MS, proximity-dependent biotin identification association, physical 26831064 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct HNRNPC Protein-RNA physical 23585894 , (Europe PMC )NA BioGRID HNRNPD Affinity Capture-MS, Affinity Capture-RNA, Two-hybrid physical 15231747 , 22431556 , 26831064 , (Europe PMC )NA BioGRID HNRNPDL Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HNRNPF Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HNRNPH1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HNRNPH2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HNRNPH3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HNRNPK Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HNRNPL Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HNRNPM Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HNRNPR Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HNRNPU Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HNRNPUL1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HNRNPUL2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HORMAD1 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID HP1BP3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HSP90AA1 Affinity Capture-MS, Affinity Capture-Western physical 24085845 , 26831064 , (Europe PMC )NA BioGRID HSP90AB1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HSP90AB2P Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HSP90B1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HSPA14 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID HSPA1L Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HSPA4 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HSPA4L Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HSPA5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HSPA8 Affinity Capture-MS, Two-hybrid physical 26831064 , 9738006 , (Europe PMC )NA BioGRID HSPA9 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HSPB1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HSPD1 Affinity Capture-Western, Two-hybrid, pull down, two hybrid physical, physical association 21988832 , (Europe PMC )0.51 BioGRID, IntAct HSPH1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID HUS1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct HUWE1 Affinity Capture-Western physical 24342616 , (Europe PMC )NA BioGRID HYOU1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID IARS Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID IFI16 Affinity Capture-Western, Co-localization, anti bait coimmunoprecipitation, confocal microscopy, pull down colocalization, physical, physical association 14654789 , 26121674 , (Europe PMC )0.56 BioGRID, IntAct IFI30 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID IGF2BP3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ILF2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ILF3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID IMPDH2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID INPP1 Affinity Capture-Western, Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID IPO5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID IPO7 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID IQGAP1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ITIH5 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID ITPR1 Affinity Capture-Western, Co-fractionation, FRET, Reconstituted Complex physical 25645916 , (Europe PMC )NA BioGRID ITPRID2 Affinity Capture-MS, Two-hybrid physical 22990118 , 26831064 , (Europe PMC )NA BioGRID JAK1 Affinity Capture-Western, coimmunoprecipitation physical, physical association 11163768 , (Europe PMC )0.40 BioGRID, IntAct, MINT JAK2 Affinity Capture-Western, coimmunoprecipitation physical, physical association 11163768 , (Europe PMC )0.40 BioGRID, IntAct, MINT JUN Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 12080089 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT JUNB Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 12080089 , 18259752 , 25184681 , 28514442 , (Europe PMC )NA BioGRID JUND Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 12080089 , (Europe PMC )NA BioGRID JUP Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct KARS Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID KAT5 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID KDM1A Affinity Capture-MS, Affinity Capture-Western, Two-hybrid physical 22990118 , 26831064 , (Europe PMC )NA BioGRID KEAP1 Affinity Capture-Western physical 22331464 , (Europe PMC )NA BioGRID KHDRBS1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID KHSRP Affinity Capture-MS, proximity-dependent biotin identification association, physical 26831064 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct KIF11 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID KIF18A proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct KIF1B Protein-peptide physical 14578343 , (Europe PMC )NA BioGRID KIF20A Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID KIF20B Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID KIF20B proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct KIF22 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID KIF23 Affinity Capture-MS, proximity-dependent biotin identification association, physical 26831064 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct KIF2A proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct KIF2C proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct KIF4A proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct KIF5B Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID KIFC1 Affinity Capture-MS, proximity-dependent biotin identification association, physical 26831064 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct KLHL22 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID KNL1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct KPNA1 two hybrid physical association 8955125 , (Europe PMC )0.37 IntAct, MINT KPNA2 Affinity Capture-MS, Two-hybrid, pull down, two hybrid physical, physical association 25184681 , 26831064 , 8955125 , 9497340 , (Europe PMC )0.51 BioGRID, IntAct KPNA3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID KPNB1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID KRT18 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID LARP1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID LARS Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID LCK Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID LCMT1 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID LDHA Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID LDHB Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID LDHC Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID LGALS3 Affinity Capture-Western physical 24755837 , (Europe PMC )NA BioGRID LGALS3BP Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID LMNA Affinity Capture-MS, cosedimentation through density gradient colocalization, physical 22193777 , 26831064 , (Europe PMC )0.35 BioGRID, IntAct, MINT LMNB1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID LMNTD1 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID LMO4 Affinity Capture-Western, Phenotypic Suppression, Reconstituted Complex, Two-hybrid genetic, physical 11751867 , 12925972 , (Europe PMC )NA BioGRID LONRF1 Two-hybrid, two hybrid array physical, physical association 22493164 , (Europe PMC )0.37 BioGRID, IntAct LRRC59 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID LRRFIP1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID LRRK1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID LUZP1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct MAGEB2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MAN2C1 Affinity Capture-Western, Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID MAP3K1 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID MAP3K14 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID MAP3K21 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MAP3K3 Affinity Capture-Western, Two-hybrid physical 15205325 , (Europe PMC )NA BioGRID MAP4 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MAP4K4 Protein-peptide physical 14578343 , (Europe PMC )NA BioGRID MAPK1 Affinity Capture-Western physical 18593910 , (Europe PMC )NA BioGRID MAPK3 Affinity Capture-Western physical 18593910 , (Europe PMC )NA BioGRID MAPKAP1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID MARCKSL1 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID MARS Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MATK Affinity Capture-Western physical 23901102 , (Europe PMC )NA BioGRID MATR3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MAU2 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct MCM2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MCM3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MCM4 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MCM5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MCM6 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MCPH1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct MCRS1 Affinity Capture-Western, Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID MDC1 Affinity Capture-Western, Co-localization, anti bait coimmunoprecipitation, imaging technique, proximity-dependent biotin identification association, colocalization, physical, physical association 12607005 , 12611903 , 15569676 , 17525332 , 19766185 , 21622030 , 29656893 , (Europe PMC )0.65 BioGRID, IntAct MDH1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MDH2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MED12 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct MED17 Co-purification physical 11504724 , 12154023 , (Europe PMC )NA BioGRID MED21 Affinity Capture-Western, Co-purification physical 9159119 , (Europe PMC )NA BioGRID MID2 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID MKI67 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID MKRN2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MLH1 Affinity Capture-MS, Affinity Capture-Western, Co-purification, anti bait coimmunoprecipitation, proximity-dependent biotin identification association, physical 10783165 , 17148452 , 21240188 , 25184681 , 29656893 , (Europe PMC )0.53 BioGRID, IntAct, MINT MMS22L proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct MNAT1 Affinity Capture-Western, Two-hybrid, two hybrid array physical, physical association 15282296 , 22493164 , (Europe PMC )0.37 BioGRID, IntAct MORC3 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct MORF4L1 Affinity Capture-Western, cosedimentation through density gradient colocalization, physical 20332121 , 22193777 , (Europe PMC )0.35 BioGRID, IntAct, MINT MORF4L2 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID MOV10 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MRE11 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Co-purification, Reconstituted Complex physical 10426999 , 10783165 , 11353843 , 11504724 , 16391231 , 17349954 , 23530059 , 25184681 , (Europe PMC )NA BioGRID MRE11 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct MRM2 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID MRPL36 Affinity Capture-Western physical 16462773 , (Europe PMC )NA BioGRID MSH2 Affinity Capture-Western, Co-purification, Phenotypic Suppression, Reconstituted Complex, Two-hybrid genetic, physical 10783165 , 11498787 , 15886699 , 24966277 , (Europe PMC )NA BioGRID MSH3 Protein-peptide, Reconstituted Complex physical 11498787 , 14578343 , (Europe PMC )NA BioGRID MSH6 Affinity Capture-MS, Co-purification, Reconstituted Complex, Two-hybrid physical 10783165 , 11498787 , 25184681 , (Europe PMC )NA BioGRID MSN Affinity Capture-MS physical 21282464 , (Europe PMC )NA BioGRID MTA2 Affinity Capture-MS physical 19703393 , 25184681 , (Europe PMC )NA BioGRID MTHFD1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MTOR Affinity Capture-Western physical 22990118 , (Europe PMC )NA BioGRID MUS81 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct MVP Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MYBBP1A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MYC Affinity Capture-Western, Co-localization, Reconstituted Complex, Two-hybrid physical 11916966 , 12646176 , 14612409 , 20215511 , 9788437 , (Europe PMC )NA BioGRID MYH10 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MYH14 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MYH9 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID MYL12A Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID MYOZ1 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID NAA15 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NABP2 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID NACA Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NAP1L1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NAT10 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID NBN Affinity Capture-MS, Affinity Capture-Western, Co-localization, Co-purification, proximity-dependent biotin identification association, physical 10426999 , 10783165 , 11504724 , 18171670 , 19244116 , 25184681 , 25659039 , 25939603 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct NCAPD3 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct NCAPG2 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct NCK1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct NCL Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NCOA1 Affinity Capture-Western, Reconstituted Complex physical 16860316 , (Europe PMC )NA BioGRID NCOA2 Protein-peptide, Reconstituted Complex physical 11085509 , 14578343 , 16860316 , (Europe PMC )NA BioGRID NCOA3 Affinity Capture-Western, Protein-peptide, Reconstituted Complex physical 14578343 , 16860316 , (Europe PMC )NA BioGRID ND1 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID NDC1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NELFB Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, confocal microscopy, pull down, two hybrid colocalization, physical, physical association 11739404 , (Europe PMC )0.60 BioGRID, IntAct NFE2L2 Affinity Capture-Western physical 23857982 , (Europe PMC )NA BioGRID NFIC proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct NFYA Affinity Capture-Western physical 11777930 , (Europe PMC )NA BioGRID NINL Affinity Capture-Western physical 19509300 , (Europe PMC )NA BioGRID NIPBL Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID NKAPL Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID NKRF Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NME1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NMI Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 11916966 , (Europe PMC )NA BioGRID NOL11 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID NOLC1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NOP2 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID NOP56 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NPC2 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID NPEPPS Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NPM1 Affinity Capture-MS, Affinity Capture-Western physical 15184379 , 26831064 , (Europe PMC )NA BioGRID NR2F2 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct NRIP1 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID NSF Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NSMCE1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct NSMCE2 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct NSMCE3 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct NSMCE4A proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct NUDC Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NUFIP1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 15107825 , (Europe PMC )NA BioGRID NUFIP2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NUMA1 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID NUP107 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NUP133 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NUP153 Affinity Capture-MS, Protein-peptide physical 14578343 , 26831064 , (Europe PMC )NA BioGRID NUP155 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NUP160 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NUP214 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID NUP93 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID OBSCN Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID ODF2 Co-localization physical 22833046 , (Europe PMC )NA BioGRID OGFR Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID OGT Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID OLA1 Affinity Capture-Western, Reconstituted Complex physical 24289923 , (Europe PMC )NA BioGRID ORC2 Affinity Capture-MS, Affinity Capture-Western physical 17525332 , 25184681 , (Europe PMC )NA BioGRID ORC3 Affinity Capture-Western, anti tag coimmunoprecipitation physical, physical association 17525332 , (Europe PMC )0.40 BioGRID, IntAct P4HB Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PA2G4 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PABPC1 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Far Western, Reconstituted Complex physical 16782705 , 23805307 , 26831064 , (Europe PMC )NA BioGRID PABPC4 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PAICS Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PALB2 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, cosedimentation through density gradient, molecular sieving, proximity-dependent biotin identification, pull down, tandem affinity purification association, colocalization, physical, physical association 19268590 , 19369211 , 19553677 , 19584259 , 22193777 , 22331464 , 23038782 , 23585894 , 24085845 , 25016020 , 25184681 , 25652403 , 26649820 , 29656893 , (Europe PMC )0.87 BioGRID, IntAct, MINT PALLD Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PARG Biochemical Activity physical 25252691 , (Europe PMC )NA BioGRID PARP1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Negative Genetic, Synthetic Lethality genetic, physical 25252691 , 26831064 , 27453043 , 28319113 , (Europe PMC )NA BioGRID PARP4 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PAX2 Affinity Capture-Western physical 21880590 , (Europe PMC )NA BioGRID PCBP1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PCBP2 Affinity Capture-RNA physical 22431556 , (Europe PMC )NA BioGRID PCLAF Affinity Capture-Western physical 21673012 , (Europe PMC )NA BioGRID PCMT1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PCMTD2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PCNA Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID PDCD6IP Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PDE12 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PDGFRA Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID PDIA4 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PDLIM5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PDS5A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PEG3 Far Western physical 11746496 , (Europe PMC )NA BioGRID PEX5 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct PFKL Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PFKM Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PFKP Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PFN1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PGAM5 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID PGD Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PGK1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PGR Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 16109739 , 21531767 , (Europe PMC )NA BioGRID PHB2 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID PHF12 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID PHGDH Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PIAS1 Biochemical Activity, Co-localization, proximity-dependent biotin identification association, physical 20016594 , 20016603 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct PIAS4 Biochemical Activity, Co-localization physical 20016594 , 20016603 , (Europe PMC )NA BioGRID PIK3R1 Reconstituted Complex, peptide array physical, physical association 16135792 , 17474147 , (Europe PMC )0.40 BioGRID, IntAct PILRB Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID PISD Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID PKM Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PLEC Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PLK1 Affinity Capture-Western, proximity-dependent biotin identification association, physical 24067368 , 25483079 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct PML proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct PMS2 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID PMS2P3 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct POLD1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct POLE proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct POLH Affinity Capture-Western physical 23901102 , (Europe PMC )NA BioGRID POLN Affinity Capture-MS, Affinity Capture-Western physical 26269593 , (Europe PMC )NA BioGRID POLR1A Affinity Capture-Western physical 27589844 , (Europe PMC )NA BioGRID POLR2A Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-purification, Reconstituted Complex physical 11504724 , 12955082 , 14506230 , 15886201 , 18197258 , 22990118 , 25184681 , 27583302 , 9159119 , (Europe PMC )NA BioGRID POLR2C Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID POLR2D Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID POLR2E Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID POLR2G Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID POLR2H Biochemical Activity physical 17283126 , 25436519 , (Europe PMC )NA BioGRID POLR2I Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID POLR2J Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID POLR2M Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID POM121 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID POMGNT1 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct POT1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct POU2F1 Affinity Capture-Western, Co-localization physical 11777930 , 18000219 , 20215511 , (Europe PMC )NA BioGRID PPA1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PPFIA1 Affinity Capture-Western, Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID PPHLN1 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID PPP1CA Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 12438214 , 17511879 , 22990118 , 25056273 , (Europe PMC )0.52 BioGRID, IntAct PPP1CB Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, two hybrid physical, physical association 17511879 , (Europe PMC )0.58 BioGRID, IntAct PPP1CC anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical association 17511879 , (Europe PMC )0.52 IntAct PPP1R13B Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID PPP1R18 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID PPP1R3A Affinity Capture-Western physical 17511879 , (Europe PMC )NA BioGRID PPP1R9B Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID PPP2CA Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID PPP2R5C Affinity Capture-Western, Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID PPP6C Affinity Capture-MS, Affinity Capture-Western physical 22990118 , 26831064 , (Europe PMC )NA BioGRID PPP6R1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID PPP6R3 Affinity Capture-MS, Affinity Capture-Western physical 22990118 , 26831064 , (Europe PMC )NA BioGRID PRAME proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct PRC1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct PRDX1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PREP Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID PRKAA2 Affinity Capture-Western, Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID PRKAG3 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID PRKCSH Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PRKDC Protein-peptide physical 10608806 , (Europe PMC )NA BioGRID PRKRA Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PRMT1 Affinity Capture-MS, Biochemical Activity, Reconstituted Complex physical 20614009 , 26831064 , (Europe PMC )NA BioGRID PRMT5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PRPF19 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PRPF3 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID PRPF39 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PRPF6 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PRR5 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID PSAP Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID PSMA1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMA5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMA6 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID PSMA7 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Far Western physical 25620702 , 26831064 , (Europe PMC )NA BioGRID PSMB5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMC1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMC2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMC3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMC4 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMC5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMC6 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMD1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMD11 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMD12 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMD13 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMD14 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMD2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMD3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMD4 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMD6 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMD7 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMD9 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID PSME3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PSMG1 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID PTBP1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID PYCARD Affinity Capture-Western, Co-localization physical 26121674 , (Europe PMC )NA BioGRID PYGL Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID QARS Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RACK1 Affinity Capture-MS physical 22990118 , 26831064 , (Europe PMC )NA BioGRID RAD1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RAD18 Affinity Capture-MS, Affinity Capture-Western, proximity-dependent biotin identification association, physical 23901102 , 25184681 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct RAD21 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID RAD23B Affinity Capture-MS, pull down physical, physical association 16712842 , (Europe PMC )0.40 BioGRID, IntAct, MINT RAD50 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Co-purification, Reconstituted Complex, Two-hybrid, proximity-dependent biotin identification association, physical 10426999 , 10783165 , 11504724 , 16391231 , 18171670 , 25084169 , 25184681 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct RAD51 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Co-purification, Reconstituted Complex, cosedimentation through density gradient, molecular sieving, proximity-dependent biotin identification association, colocalization, physical, physical association 11498787 , 14636569 , 19369211 , 19766185 , 22193777 , 24085845 , 25499220 , 25659039 , 29656893 , 9008167 , 9774970 , (Europe PMC )0.67 BioGRID, IntAct, MINT RAD51B proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RAD52 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RAD54L2 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RAD9A proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RALY Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RAN Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RANBP9 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID RANGAP1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RARS Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RB1 Affinity Capture-Western, Co-localization, Negative Genetic, Reconstituted Complex genetic, physical 10220405 , 10518542 , 11521194 , 28319113 , (Europe PMC )NA BioGRID RBBP4 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 10220405 , 26831064 , (Europe PMC )NA BioGRID RBBP5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RBBP7 Affinity Capture-Western, Far Western, Reconstituted Complex, Two-hybrid physical 10220405 , 11394910 , 11746496 , (Europe PMC )NA BioGRID RBBP8 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-localization, Protein-peptide, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, molecular sieving, proximity-dependent biotin identification, pull down, tandem affinity purification, two hybrid association, physical, physical association 10196224 , 10764811 , 10910365 , 11689934 , 11739404 , 14578343 , 16818604 , 16843262 , 17525340 , 17525342 , 18171670 , 18285836 , 19369211 , 19452558 , 20351172 , 21908405 , 23416467 , 24085845 , 25184681 , 25252691 , 25310973 , 25659039 , 26387952 , 26446986 , 29656893 , 9738006 , 9811458 , (Europe PMC )0.87 BioGRID, IntAct RBL1 Co-localization, Reconstituted Complex physical 11521194 , (Europe PMC )NA BioGRID RBL2 Co-localization, Reconstituted Complex physical 11521194 , (Europe PMC )NA BioGRID RBM14 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RBM28 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID RBM45 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RBM6 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RCC1L Affinity Capture-Western, Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID RCHY1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RCL1 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID RDX Affinity Capture-MS physical 21282464 , (Europe PMC )NA BioGRID RECQL proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RECQL4 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RECQL5 Affinity Capture-MS, proximity-dependent biotin identification association, physical 22990118 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct RELA Affinity Capture-Western, Reconstituted Complex physical 12700228 , 21908405 , (Europe PMC )NA BioGRID REV1 Affinity Capture-Western physical 23901102 , (Europe PMC )NA BioGRID RFC1 Affinity Capture-MS, Co-purification physical 10783165 , 25184681 , (Europe PMC )NA BioGRID RFC2 Affinity Capture-MS physical 22990118 , 25184681 , (Europe PMC )NA BioGRID RFC4 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID RHNO1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RICTOR Affinity Capture-MS, Affinity Capture-Western physical 22990118 , (Europe PMC )NA BioGRID RIF1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RMI1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RMI2 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RNF168 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RNF169 Affinity Capture-MS, proximity-dependent biotin identification association, physical 25184681 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct RNF216 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID RNF6 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RNF8 fluorescence microscopy colocalization 18001825 , (Europe PMC )0.27 IntAct RNGTT Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID RNMT Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPA1 Affinity Capture-Western, Co-localization, anti bait coimmunoprecipitation, molecular sieving, proximity-dependent biotin identification association, physical, physical association 19369211 , 19766185 , 21240188 , 23901102 , 29656893 , (Europe PMC )0.67 BioGRID, IntAct, MINT RPA2 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RPA3 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct RPAP2 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID RPAP3 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID RPGRIP1 Affinity Capture-Western, Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID RPL10 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL10A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL11 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL12 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL13 two hybrid physical association 16452482 , (Europe PMC )0.37 IntAct RPL14 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL15 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL17 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL18 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL18A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL21 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID RPL23 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL23A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL24 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL27 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL27A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL28 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID RPL29 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL3 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID RPL30 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL31 Affinity Capture-MS, Far Western, Reconstituted Complex physical 11746496 , 26831064 , (Europe PMC )NA BioGRID RPL32 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID RPL34 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID RPL35 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL36 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL37A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL4 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL6 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL7 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL7A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL8 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPL9 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPLP1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPLP2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPRD1A Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID RPRD1B Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID RPS11 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS12 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS13 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID RPS14 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS15A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS16 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS18 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS19 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS23 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS24 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS25 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS27 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID RPS3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS3A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS6 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS7 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID RPS8 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPS9 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RPSA Affinity Capture-MS, Co-localization physical 22814251 , 26831064 , (Europe PMC )NA BioGRID RPTOR Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RSL1D1 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID RTKN2 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID RTL10 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID RUNX1 Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID RUNX1T1 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID RUVBL1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID RUVBL2 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID RWDD2B Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID RWDD4 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID SAGE1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct SART3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SDK2 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID SEC13 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SEC16A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SEC23A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SEC23B Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SEC23IP Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SEC24B Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SEC24C Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SEC31A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SEM1 Two-hybrid physical 17563742 , (Europe PMC )NA BioGRID SEPT2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SEPT7 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SEPT9 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SERPINH1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SETD1A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SETX Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Synthetic Growth Defect, Two-hybrid genetic, physical 25184681 , 25699710 , (Europe PMC )NA BioGRID SETX proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct SF3A1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SF3A3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SF3B1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SF3B2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SF3B3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SFPQ Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SGO2 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct SH2B1 Affinity Capture-Western physical 17565041 , (Europe PMC )NA BioGRID SKP1 Affinity Capture-Western physical 23086937 , (Europe PMC )NA BioGRID SKP2 Affinity Capture-Western, Biochemical Activity physical 23086937 , 25659039 , (Europe PMC )NA BioGRID SLAIN2 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID SLC39A10 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SLC39A6 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SLF1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct SLF2 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct SLX4 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct SLX4IP proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct SMAD3 Affinity Capture-Western, Reconstituted Complex physical 15735739 , 19768112 , (Europe PMC )NA BioGRID SMARCA2 Affinity Capture-Western physical 15034933 , 27591253 , (Europe PMC )NA BioGRID SMARCA4 Affinity Capture-MS, Affinity Capture-Western, Co-purification, Reconstituted Complex physical 10943845 , 15034933 , 23438604 , 26831064 , (Europe PMC )NA BioGRID SMARCA5 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID SMARCB1 Affinity Capture-Western, Co-purification physical 10943845 , 27591253 , (Europe PMC )NA BioGRID SMARCC1 Affinity Capture-MS, Co-purification physical 10943845 , 26831064 , (Europe PMC )NA BioGRID SMARCC2 Affinity Capture-MS, Co-purification physical 10943845 , 26831064 , (Europe PMC )NA BioGRID SMARCD2 Co-purification physical 10943845 , (Europe PMC )NA BioGRID SMC1A Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 11877377 , 25184681 , 26831064 , (Europe PMC )0.40 BioGRID, IntAct SMC3 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID SMC5 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct SMC6 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct SMCHD1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct SMTN proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct SND1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SNRNP200 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid physical 22990118 , 26831064 , (Europe PMC )NA BioGRID SNRPD3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SNX3 Affinity Capture-Western, Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID SNX6 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID SNX9 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SOX30 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID SP1 Affinity Capture-Western, Reconstituted Complex physical 12706836 , 17766039 , (Europe PMC )NA BioGRID SPAG9 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SPATA4 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID SPTAN1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SPTBN1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SRP68 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SRP72 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SRSF1 Affinity Capture-MS, Affinity Capture-RNA physical 18391021 , 22990118 , (Europe PMC )NA BioGRID SSB Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SSRP1 Co-localization, Synthetic Growth Defect genetic, physical 25184681 , (Europe PMC )NA BioGRID SSX2IP Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID STAC2 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID STAG1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct STAT1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 10792030 , (Europe PMC )NA BioGRID STAT5A Affinity Capture-Western physical 12459499 , (Europe PMC )NA BioGRID STAU1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID STIP1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID STN1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct STRAP Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID STRN Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID SUMO1 Affinity Capture-MS, Affinity Capture-Western, FRET, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, fluorescent resonance energy transfer, pull down direct interaction, physical, physical association 18025037 , 20016594 , 26831064 , (Europe PMC )0.60 BioGRID, IntAct SUMO2 Affinity Capture-MS physical 22689573 , (Europe PMC )NA BioGRID SUMO2 anti tag coimmunoprecipitation, pull down physical association 20016594 , 20016603 , (Europe PMC )0.59 IntAct SUPT16H Affinity Capture-MS, Co-localization, Synthetic Growth Defect genetic, physical 25184681 , 26831064 , (Europe PMC )NA BioGRID SUPT5H Affinity Capture-Western physical 18197258 , (Europe PMC )NA BioGRID SUPT6H Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID SUZ12 Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 23624935 , (Europe PMC )0.35 BioGRID, IntAct, MINT SYNCRIP Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID SYT6 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID TAF15 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TAF1B Affinity Capture-Western physical 27589844 , (Europe PMC )NA BioGRID TALDO1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TARDBP Affinity Capture-RNA physical 18391021 , (Europe PMC )NA BioGRID TARS Affinity Capture-MS, Two-hybrid physical 22990118 , 26831064 , (Europe PMC )NA BioGRID TATDN2 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID TBL3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TCEA2 Synthetic Growth Defect, Two-hybrid genetic, physical 25184681 , (Europe PMC )NA BioGRID TCEANC Synthetic Growth Defect, Two-hybrid genetic, physical 25184681 , (Europe PMC )NA BioGRID TCOF1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TCP1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TCTEX1D2 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID TERF1 Affinity Capture-Western, proximity-dependent biotin identification association, physical 19797051 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct TERF2 Affinity Capture-MS, Affinity Capture-Western, proximity-dependent biotin identification association, physical 19797051 , 25184681 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct TERF2IP proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct TEX101 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID TFAP2A Affinity Capture-Western physical 21363924 , (Europe PMC )NA BioGRID TFAP2C Affinity Capture-Western physical 21363924 , (Europe PMC )NA BioGRID TFAP4 Affinity Capture-MS physical 19505873 , (Europe PMC )NA BioGRID TFG Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TFRC Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID THEGL Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID THOC3 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID TIAL1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TINF2 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct TKT Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TLE4 Affinity Capture-Western, Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID TLN1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TMPRSS12 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID TNPO1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TNRC6A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TNRC6B Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TNRC6C Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TNS2 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID TONSL Affinity Capture-MS, Affinity Capture-Western, Co-localization, Synthetic Growth Defect, proximity-dependent biotin identification association, genetic, physical 25184681 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct TOP1 Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID TOP2A Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, pull down physical, physical association 15965487 , 25184681 , (Europe PMC )0.52 BioGRID, IntAct TOP3A proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct TOPBP1 Affinity Capture-MS, Affinity Capture-Western, Co-localization, proximity-dependent biotin identification association, physical 16391231 , 19766185 , 23157317 , 23901102 , 25184681 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct TP53 Affinity Capture-MS, Affinity Capture-Western, Co-purification, Reconstituted Complex, coimmunoprecipitation, pull down direct interaction, physical, physical association 14636569 , 14710355 , 15571721 , 16677609 , 16969499 , 19509300 , 21742769 , 26140185 , 9482880 , 9582019 , 9926942 , (Europe PMC )0.54 BioGRID, IntAct, MINT TP53BP1 Affinity Capture-MS, Affinity Capture-Western, Co-localization physical 12364621 , 17525332 , 21552324 , 26831064 , (Europe PMC )NA BioGRID TP53BP1 anti bait coimmunoprecipitation, confocal microscopy, proximity-dependent biotin identification association, colocalization, physical association 17525332 , 18001824 , 22884692 , 29656893 , (Europe PMC )0.71 IntAct TP63 Affinity Capture-Western, Co-localization physical 21363924 , 24556685 , (Europe PMC )NA BioGRID TP73 Affinity Capture-Western physical 20807817 , (Europe PMC )NA BioGRID TPI1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TPM1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID TPM3 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID TPP2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TPR Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TPTE2 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID TPX2 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, proximity-dependent biotin identification association, physical 22110403 , 25184681 , 29656893 , (Europe PMC )0.53 BioGRID, IntAct TRA2B Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TRIM24 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct TRIM25 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TRIM27 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct TRIM28 Affinity Capture-MS, proximity-dependent biotin identification association, physical 26831064 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct TRIM33 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct TRIM46 Two-hybrid, two hybrid array physical, physical association 22493164 , (Europe PMC )0.37 BioGRID, IntAct TRIM74 Two-hybrid, two hybrid array physical, physical association 22493164 , (Europe PMC )0.37 BioGRID, IntAct TRNAU1AP Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TROAP Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TSEN54 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID TSGA10IP Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID TTN Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TUBA1C Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TUBA4A Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TUBB Affinity Capture-MS, Affinity Capture-Western physical 12353262 , 26831064 , (Europe PMC )NA BioGRID TUBB3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TUBB4B Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TUBB6 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TUBB8 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID TUBG1 Affinity Capture-Western, Biochemical Activity, Co-localization, Co-purification, Reconstituted Complex physical 11691781 , 15367667 , 22262852 , 22833046 , 24289923 , 9789027 , (Europe PMC )NA BioGRID TULP2 Affinity Capture-Western, Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID TXLNA Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID UBA1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID UBAP2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID UBAP2L Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID UBC Biochemical Activity, Reconstituted Complex physical 17349954 , 17525341 , (Europe PMC )NA BioGRID UBE2D1 Co-crystal Structure, Reconstituted Complex, Two-hybrid physical 11278247 , 12485996 , 12732733 , 12887909 , 12890688 , 14636569 , 14638690 , 16403807 , 19712108 , 19916563 , 24507701 , (Europe PMC )NA BioGRID UBE2D2 Co-crystal Structure, Reconstituted Complex, Two-hybrid physical 19712108 , 21113135 , (Europe PMC )NA BioGRID UBE2D3 Affinity Capture-Western, Co-crystal Structure, Reconstituted Complex, Two-hybrid physical 11927591 , 12438698 , 15367667 , 15886201 , 15905410 , 16628214 , 16818604 , 17283126 , 17349954 , 19712108 , 20351172 , 21113135 , 21531767 , 21532592 , 21756275 , 21965653 , 22863316 , 23246971 , 25355358 , (Europe PMC )NA BioGRID UBE2E1 Co-crystal Structure, Reconstituted Complex, Two-hybrid physical 17873885 , 19712108 , 21965653 , (Europe PMC )NA BioGRID UBE2E2 Co-crystal Structure, Reconstituted Complex, Two-hybrid physical 17873885 , 19712108 , 21965653 , (Europe PMC )NA BioGRID UBE2E3 Co-crystal Structure, Reconstituted Complex, Two-hybrid physical 17873885 , 19712108 , 21965653 , (Europe PMC )NA BioGRID UBE2I Affinity Capture-Western, Biochemical Activity, FRET physical 19287951 , 20016594 , (Europe PMC )NA BioGRID UBE2J1 Two-hybrid, two hybrid array physical, physical association 19690564 , (Europe PMC )0.37 BioGRID, IntAct UBE2K Co-crystal Structure, Reconstituted Complex, Two-hybrid physical 17873885 , 19712108 , 21965653 , 23246971 , (Europe PMC )NA BioGRID UBE2L3 Co-crystal Structure, Reconstituted Complex, Two-hybrid physical 12732733 , 19712108 , (Europe PMC )NA BioGRID UBE2N Co-crystal Structure, Reconstituted Complex, Two-hybrid physical 17873885 , 19712108 , 21965653 , (Europe PMC )NA BioGRID UBE2T Reconstituted Complex physical 19887602 , (Europe PMC )NA BioGRID UBE2W Co-crystal Structure, Reconstituted Complex, Two-hybrid physical 17873885 , 19712108 , 21965653 , 25436519 , (Europe PMC )NA BioGRID UBE3A Reconstituted Complex physical 12890688 , (Europe PMC )NA BioGRID UBR1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID UBR2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID UBTF Affinity Capture-Western physical 27589844 , (Europe PMC )NA BioGRID UBXN1 Affinity Capture-Western, Reconstituted Complex physical 20351172 , (Europe PMC )NA BioGRID UCHL5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID UGGT1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID UIMC1 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation, fluorescence microscopy, proximity-dependent biotin identification, pull down, tandem affinity purification association, colocalization, direct interaction, physical, physical association 17525340 , 17525341 , 17525342 , 17621610 , 17643121 , 19261748 , 19305427 , 19615732 , 19766185 , 21622030 , 24085845 , 25184681 , 25252691 , 26446986 , 28569838 , 29656893 , (Europe PMC )0.40, 0.72 BioGRID, IntAct UPF1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID USF2 Affinity Capture-Western physical 14502648 , (Europe PMC )NA BioGRID USH2A Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID USO1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID USP2 Two-hybrid physical 22990118 , 23105109 , (Europe PMC )NA BioGRID USP37 Proximity Label-MS physical 26299517 , (Europe PMC )NA BioGRID USP7 Affinity Capture-MS physical 25184681 , 26831064 , (Europe PMC )NA BioGRID UTP4 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID VARS Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID VCAM1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct VCL Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID VCP Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 10855792 , 26831064 , (Europe PMC )NA BioGRID VDR Affinity Capture-Western physical 19074549 , (Europe PMC )NA BioGRID VEGFA Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID VPS35 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID VSIG8 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID WAPL Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID WDR48 Affinity Capture-MS physical 19615732 , (Europe PMC )NA BioGRID WDR5 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID WDR6 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID WEE1 Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID WIZ Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID WNT2B Far Western physical 11746496 , (Europe PMC )NA BioGRID WRN proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct WRNIP1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct WWOX Affinity Capture-Western, Reconstituted Complex physical 27869163 , (Europe PMC )NA BioGRID XIAP Affinity Capture-Western, Reconstituted Complex physical 16322207 , (Europe PMC )NA BioGRID XIST Co-localization physical 12419249 , 15065664 , (Europe PMC )NA BioGRID XPO1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID XRCC5 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 18936166 , 23344954 , 26831064 , (Europe PMC )NA BioGRID XRCC6 Affinity Capture-MS physical 22990118 , 26831064 , (Europe PMC )NA BioGRID XRN2 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID YBX1 Affinity Capture-MS physical 22990118 , 26831064 , (Europe PMC )NA BioGRID YTHDF3 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID YWHAE Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID YWHAQ Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID YWHAZ Affinity Capture-MS physical 22990118 , 26831064 , (Europe PMC )NA BioGRID ZBTB1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct ZBTB14 Affinity Capture-Western physical 21880590 , (Europe PMC )NA BioGRID ZBTB47 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ZBTB48 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct ZC3H11A Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID ZC3HAV1 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID ZCCHC8 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 17525332 , (Europe PMC )0.52 BioGRID, IntAct ZDHHC5 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID ZFR Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ZHX1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct ZMIZ1 Affinity Capture-MS physical 26522984 , (Europe PMC )NA BioGRID ZNF207 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct ZNF280D Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID ZNF326 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ZNF350 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, coimmunoprecipitation, pull down, two hybrid physical, physical association 11090615 , 16843262 , 23991171 , (Europe PMC )0.58 BioGRID, IntAct ZNF423 Two-hybrid physical 25184681 , (Europe PMC )NA BioGRID ZNF827 Co-localization, proximity-dependent biotin identification association, physical 25150861 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct ZSCAN21 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID ZYG11B Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID ZZZ3 Affinity Capture-MS physical 25184681 , (Europe PMC )NA BioGRID
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
AKT1 S694_QTSKRHDsDTFPELK , T462_NIEDKIFtKTYRKKA , T468_FGKTYRKtASLPNLS , T509_LKRKRRPtSGLHPED , in vitro, in vivo 10542266 ,(Europe PMC )HPRD, PhosphoSitePlus , ATM S1142_QPMGSSHsSQVCSET , S1148_HASQVCSsTPDDLLD , S1189_QKGELSRsPSPFTHT , S1283_LAKASQEsHLSEETK , S1289_EHHLSEEsKCSASLF , S1330_QMRHQSEsQGVGLSD , S1340_VGLSDKEsVSDDEER , S1346_ELVSDDEsRGTGLEE , S1376_ASGCESEsSVSEDCS , S1382_ETSVSEDsSGLSSQS , S1387_EDCSGLSsQSDILTT , S1410_NLIKLQQsMAELEAV , S1416_QEMAELEsVLEQHGS , S1423_AVLEQHGsQPSNSYP , S1457_SEKAVLTsQKSSEYP , S1466_KSSEYPIsQNPEGLS , S1477_EGLSADKsEVSADSS , S1483_KFEVSADsSTSKNKE , S1495_NKEPGVEsSSPSKCP , S1497_EPGVERSsPSKCPSL , S1501_ERSSPSKsPSLDDRW , S1524_LQNRNYPsQEELIKV , S1542_EEQQLEEsGPHDLTE , S243_TEHHQPSsNDLNTTE , S245_HHQPSNNsLNTTEKR , S279_EPCGTNTsASSLQHE , S281_CGTNTHAsSLQHENS , S284_NTHASSLsHENSSLL , S313_NKSKQPGsARSQHNR , S315_SKQPGLAsSQHNRWA , S320_LARSQHNsWAGSKET , S353_PLCERKEsNKQKLPC , S380_ITLNSSIsKVNEWFS , S382_LNSSIQKsNEWFSRS , S398_ELLGSDDsHDGESES , S400_LGSDDSHsGESESNA , S420_LDVLNEVsEYSGSSE , S438_LLASDPHsALICKSE , LTP, in vitro, in vivo 10550055 , 10866324 , 11278964 , 12183412 , 15159397 , 19651622 , 20068231 ,(Europe PMC )HPRD, PhosphoELM , PhosphoSitePlus , ATR S1096_LQPEVYKsSLPGSNC , S1102_KQSLPGSsCKHPEIK , S1143_PMGSSHAsQVCSETP , S1233_FQHLLFGsVNNIPSQ , S1239_GKVNNIPsQSTRHST , S1280_QVILAKAsQEHHLSE , S1376_ASGCESEsSVSEDCS , S1382_ETSVSEDsSGLSSQS , S1387_EDCSGLSsQSDILTT , S1410_NLIKLQQsMAELEAV , S1416_QEMAELEsVLEQHGS , S1423_AVLEQHGsQPSNSYP , S1457_SEKAVLTsQKSSEYP , S1524_LQNRNYPsQEELIKV , S279_EPCGTNTsASSLQHE , S281_CGTNTHAsSLQHENS , S313_NKSKQPGsARSQHNR , S315_SKQPGLAsSQHNRWA , S320_LARSQHNsWAGSKET , S353_PLCERKEsNKQKLPC , T1347_LVSDDEEtGTGLEEN , T1353_ERGTGLEtNNQEEQS , T1394_SQSDILTtQQRDTMQ , T250_NNDLNTTtKRAAERH , T252_DLNTTEKtAAERHPE , T291_QHENSSLtLTKDRMN , LTP, in vitro, in vivo 11114888 , 11278964 , 15159397 , 20068231 ,(Europe PMC )HPRD, PhosphoELM , PhosphoSitePlus , AURKA S308_KAEFCNKsKQPGLAR , in vitro, in vivo 14990569 ,(Europe PMC )HPRD, PhosphoSitePlus , Aurora A S308_KAEFCNKsKQPGLAR , LTP 14990569 ,(Europe PMC )PhosphoELM , CDK1 S1189_QKGELSRsPSPFTHT , S1191_GELSRSPsPFTHTHL , S1497_EPGVERSsPSKCPSL , NA NA PhosphoSitePlus , CDK2 S1450_RNPEQSTsEKAVLTS , S1456_TSEKAVLsSQKSSEY , S1497_EPGVERSsPSKCPSL , S353_PLCERKEsNKQKLPC , S355_CERKEWNsQKLPCSE , S393_FSRSDELsGSDDSHD , T967_GNETGLItPNKHGLL , LTP, in vitro, in vivo 10373534 ,(Europe PMC )HPRD, PhosphoELM , PhosphoSitePlus , CDK4 S632_LVVSRNLsPPNCTEL , NA NA PhosphoSitePlus , CHEK2 S941_QKDKPVDsAKCSIKG , S947_DNAKCSIsGGSRFCL , S988_PPLFPIKsFVKTKCK , in vitro, in vivo 10724175 , 12111733 ,(Europe PMC )HPRD, PhosphoSitePlus , CHK2 S988_PPLFPIKsFVKTKCK , LTP 12111733 , 14701743 ,(Europe PMC )PhosphoELM , CSNK2A1 S1572_ESGISLFsDDPESDP , in vitro 10403822 ,(Europe PMC )HPRD, PhosphoSitePlus , CSNK2B S1525_QNRNYPSsEELIKVV , S1531_SQEELIKsVDVEEQQ , S428_EYSGSSEsIDLLASD , S430_SGSSEKIsLLASDPH , S468_FGKTYRKsASLPNLS , in vitro 10403822 ,(Europe PMC )HPRD, FRK Y1552_HDLTETSyLPRQDLE , NA NA PhosphoSitePlus , PKB_group T509_LKRKRRPtSGLHPED , LTP 10542266 ,(Europe PMC )PhosphoELM , PLK1 S1164_GEIKEDTsFAENDIK , NA NA PhosphoSitePlus , Unknown S1007_EENFEEHsMSPEREM , S1009_NFEEHSMsPEREMGN , S1117_KQEYEEVsQTVNTDF , S1123_VVQTVNTsFSPYLIS , S1140_LEQPMGSsHASQVCS , S1144_MGSSHASsVCSETPD , S1146_SSHASQVsSETPDDL , S114_FAKKENNsPEHLKDE , S1150_SQVCSETsDDLLDDG , S1164_GEIKEDTsFAENDIK , S1165_EIKEDTSsAENDIKE , S1170_TSFAENDsKESSAVF , S1171_SFAENDIsESSAVFS , S1176_DIKESSAsFSKSVQK , S1177_IKESSAVsSKSVQKG , S1187_SVQKGELsRSPSPFT , S1189_QKGELSRsPSPFTHT , S1191_GELSRSPsPFTHTHL , S1192_ELSRSPSsFTHTHLA , S1198_SPFTHTHsAQGYRRG , S1204_HLAQGYRsGAKKLES , S1211_RGAKKLEsSEENLSS , S1212_GAKKLESsEENLSSE , S1217_ESSEENLsSEDEELP , S1218_SSEENLSsEDEELPC , S1239_GKVNNIPsQSTRHST , S1245_PSQSTRHsTVATECL , S1281_VILAKASsEHHLSEE , S1286_ASQEHHLsEETKCSA , S1287_SQEHHLSsETKCSAS , S1289_EHHLSEEsKCSASLF , S1295_ETKCSASsFSSQCSE , S1301_SLFSSQCsELEDLTA , S1328_SKQMRHQsESQGVGL , S1330_QMRHQSEsQGVGLSD , S1336_ESQGVGLsDKELVSD , S1342_LSDKELVsDDEERGT , S1413_KLQQEMAsLEAVLEQ , S1419_AELEAVLsQHGSQPS , S1425_LEQHGSQsSNSYPSI , S1452_PEQSTSEsAVLTSQK , S1457_SEKAVLTsQKSSEYP , S1458_EKAVLTSsKSSEYPI , S1460_AVLTSQKsSEYPISQ , S1466_KSSEYPIsQNPEGLS , S1481_ADKFEVSsDSSTSKN , S1497_EPGVERSsPSKCPSL , S1499_GVERSSPsKCPSLDD , S1524_LQNRNYPsQEELIKV , S1530_PSQEELIsVVDVEEQ , S1536_IKVVDVEsQQLEESG , S1542_EEQQLEEsGPHDLTE , S1545_QLEESGPsDLTETSY , S1563_QDLEGTPsLESGISL , S1577_LFSDDPEsDPSEDRA , S1598_GNIPSSTsALKVPQL , S316_KQPGLARsQHNRWAG , S318_PGLARSQsNRWAGSK , S322_RSQHNRWsGSKETCN , S324_QHNRWAGsKETCNDR , S348_DLNADPLsERKEWNK , S351_ADPLCERsEWNKQKL , S354_LCERKEWsKQKLPCS , S355_CERKEWNsQKLPCSE , S356_ERKEWNKsKLPCSEN , S357_RKEWNKQsLPCSENP , S358_KEWNKQKsPCSENPR , S362_KQKLPCSsNPRDTED , S364_KLPCSENsRDTEDVP , S376_DVPWITLsSSIQKVN , S379_WITLNSSsQKVNEWF , S382_LNSSIQKsNEWFSRS , S385_SIQKVNEsFSRSDEL , S387_QKVNEWFsRSDELLG , S393_FSRSDELsGSDDSHD , S395_RSDELLGsDDSHDGE , S398_ELLGSDDsHDGESES , S403_DDSHDGEsESNAKVA , S405_SHDGESEsNAKVADV , S420_LDVLNEVsEYSGSSE , S423_LNEVDEYsGSSEKID , S426_VDEYSGSsEKIDLLA , S433_SEKIDLLsSDPHEAL , S434_EKIDLLAsDPHEALI , S435_KIDLLASsPHEALIC , S438_LLASDPHsALICKSE , S473_RKKASLPsLSHVTEN , S647_QIDSCSSsEEIKKKK , S653_SSEEIKKsKYNQMPV , S67_QCPLCKNsITKRSLQ , S694_QTSKRHDsDTFPELK , S706_ELKLTNAsGSFTKCS , S712_APGSFTKsSNTSELK , S753_DPKDLMLsGERVLQT , S960_CLSSQFRsNETGLIT , S962_SSQFRGNsTGLITPN , S966_RGNETGLsTPNKHGL , S968_NETGLITsNKHGLLQ , T1149_ASQVCSEtPDDLLDD , T1155_ETPDDLLtDGEIKED , T1196_SPSPFTHtHLAQGYR , T1653_VNKRMSMtVSGLTPE , T1659_MVVSGLTtEEFMLVY , T1673_YKFARKHtITLTNLI , T1679_HHITLTNtITEETTH , T1700_AEFVCERtLKYFLGI , T1720_VVSYFWVtQSIKERK , T556_TNSGHENtTKGDSIQ , T558_SGHENKTtGDSIQNE , T576_NPIESLEtESAFKTK , T578_IESLEKEtAFKTKAE , T596_SSISNMEtELNIHNS , T616_NRLRRKStTRHIHAL , Y1155_ETPDDLLyDGEIKED , Y1161_LDDGEIKyDTSFAEN , Y1202_HTHLAQGyRRGAKKL , HTP, LTP, in vivo 10550055 , 17081983 , 17525332 , 18220336 , 18452278 , 18669648 , 19651622 , 20068231 ,(Europe PMC )HPRD, PhosphoELM ,