Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
ADD2
Gene Name  | ADD2 (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: NA |
| Synonyms | ADD2, ADDB | |
| Protein Name | ADD2 | |
| Alternative Name(s) | Beta-adducin;Erythrocyte adducin subunit beta; | |
| Protein Family | Belongs to the aldolase class II family Adducinsubfamily | |
| EntrezGene ID | 119 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P35612 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 80854 Dalton | |
| Protein Length | 726 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000075340 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - KOG3699 | eggNOG - COG0235 | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm, cytoskeleton Cell membrane;Peripheral membrane protein; Cytoplasmic side | |||
| Function (UniProt annotation) | |||
| Membrane-cytoskeleton-associated protein that promotesthe assembly of the spectrin-actin network Binds to theerythrocyte membrane receptor SLC2A1/GLUT1 and may thereforeprovide a link between the spectrin cytoskeleton to the plasmamembrane Binds to calmodulin Calmodulin binds preferentially tothe beta subunit | |||
| Catalytic Activity (UniProt annotation) | |||
| N/A | |||
| Protein Sequence | |||
| MSEETVPEAASPPPPQGQPYFDRFSEDDPEYMRLRNRAADLRQDFNLMEQKKRVTMILQSPSFREELEGLIQEQMKKGNN SSNIWALRQIADFMASTSHAVFPTSSMNVSMMTPINDLHTADSLNLAKGERLMRCKISSVYRLLDLYGWAQLSDTYVTLR VSKEQDHFLISPKGVSCSEVTASSLIKVNILGEVVEKGSSCFPVDTTGFCLHSAIYAARPDVRCIIHLHTPATAAVSAMK WGLLPVSHNALLVGDMAYYDFNGEMEQEADRINLQKCLGPTCKILVLRNHGVVALGDTVEEAFYKIFHLQAACEIQVSAL SSAGGVENLILLEQEKHRPHEVGSVQWAGSTFGPMQKSRLGEHEFEALMRMLDNLGYRTGYTYRHPFVQEKTKHKSEVEI PATVTAFVFEEDGAPVPALRQHAQKQQKEKTRWLNTPNTYLRVNVADEVQRSMGSPRPKTTWMKADEVEKSSSGMPIRIE NPNQFVPLYTDPQEVLEMRNKIREQNRQDVKSAGPQSQLLASVIAEKSRSPSTESQLMSKGDEDTKDDSEETVPNPFSQL TDQELEEYKKEVERKKLELDGEKETAPEEPGSPAKSAPASPVQSPAKEAETKSPLVSPSKSLEEGTKKTETSKAATTEPE TTQPEGVVVNGREEEQTAEEILSKGLSQMTTSADTDVDTSKDKTESVTSGPMSPEGSPSKSPSKKKKKFRTPSFLKKSKK KEKVES | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0003779 | F:actin binding |
| GO:0005198 | F:structural molecule activity |
| GO:0005516 | F:calmodulin binding |
| GO:0005829 | C:cytosol |
| GO:0007416 | P:synapse assembly |
| GO:0008290 | C:F-actin capping protein complex |
| GO:0014069 | C:postsynaptic density |
| GO:0019901 | F:protein kinase binding |
| GO:0030036 | P:actin cytoskeleton organization |
| GO:0030097 | P:hemopoiesis |
| GO:0030507 | F:spectrin binding |
| GO:0031410 | C:cytoplasmic vesicle |
| GO:0032092 | P:positive regulation of protein binding |
| GO:0042803 | F:protein homodimerization activity |
| GO:0044853 | C:plasma membrane raft |
| GO:0046982 | F:protein heterodimerization activity |
| GO:0050900 | P:leukocyte migration |
| GO:0050901 | P:leukocyte tethering or rolling |
| GO:0051015 | F:actin filament binding |
| GO:0051016 | P:barbed-end actin filament capping |
| GO:0051017 | P:actin filament bundle assembly |
| GO:0055085 | P:transmembrane transport |
| GO:0065003 | P:protein-containing complex assembly |
