Top
RPAP2
Localization (UniProt annotation) Cytoplasm Nucleus Note=Shuttles between thecytoplasm and the nucleus in a CRM1-dependent manner Function (UniProt annotation) Protein phosphatase that displays CTD phosphataseactivity and regulates transcription of snRNA genes Recognizesand binds phosphorylated 'Ser-7' of the C-terminal heptapeptiderepeat domain (CTD) of the largest RNA polymerase II subunitPOLR2A, and mediates dephosphorylation of 'Ser-5' of the CTD,thereby promoting transcription of snRNA genes Catalytic Activity (UniProt annotation) [a protein]-serine/threonine phosphate + H(2)O= [a protein]-serine/threonine + phosphate Protein Sequence MADFAGPSSAGRKAGAPRCSRKAAGTKQTSTLKQEDASKRKAELEAAVRKKIEFERKALHIVEQLLEENITEEFLMECGR
FITPAHYSDVVDERSIVKLCGYPLCQKKLGIVPKQKYKISTKTNKVYDITERKSFCSNFCYQASKFFEAQIPKTPVWVRE
EERHPDFQLLKEEQSGHSGEEVQLCSKAIKTSDIDNPSHFEKQYESSSSSTHSDSSSDNEQDFVSSILPGNRPNSTNIRP
QLHQKSIMKKKAGHKANSKHKDKEQTVVDVTEQLGDCKLDSQEKDATCELPLQKVNTQSSSNSTLPERLKASENSESEYS
RSEITLVGISKKSAEHFKRKFAKSNQVSRSVSSSVQVCPEVGKRNLLKVLKETLIEWKTEETLRFLYGQNYASVCLKPEA
SLVKEELDEDDIISDPDSHFPAWRESQNSLDESLPFRGSGTAIKPLPSYENLKKETEKLNLRIREFYRGRYVLGEETTKS
QDSEEHDSTFPLIDSSSQNQIRKRIVLEKLSKVLPGLLVPLQITLGDIYTQLKNLVRTFRLTNRNIIHKPAEWTLIAMVL
LSLLTPILGIQKHSQEGMVFTRFLDTLLEELHLKNEDLESLTIIFRTSCLPE
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
Download FASTA sequences of RPAP2-substrates in HumansSubstrate Gene Name Substrate UniProt_AC DephosphoSite and sequence (+/-5) Bioassay Type PubMed ID View in Europe PMC Reliability of the interaction POLR2A P24928 Ser-1619,Ser-1647,Ser-1661,Ser-1675,Ser-1689,Ser-1703,Ser-1717,Ser-1731,Ser-1766,Ser-1794_SYSPTsPSYSP , In vitro and in vivo 22137580 , Europe PMC
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-6807505 RNA polymerase II transcribes snRNA genes. Small nuclear RNAs (snRNAs) play key roles in splicing and some of them, specifically the U1 and U2 snRNAs, are encoded by multicopy snRNA gene clusters containing tandem arrays of genes, about 30 in the RNU1 cluster (Bernstein et al. 1985) and about 10-20 in the RNU2 cluster (Van Ardsell and Weiner 1984). Whereas U6 snRNA genes are transcribed by RNA polymerase III, U1,U2, U4, U4atac, U5, U11, and U12 genes are transcribed by RNA polymerase II. Transcription of the U1 and U2 genes has been most extensively studied and the other snRNA genes as well as other genes with similar promoter structures, for example the SNORD13 gene, are inferred to be transcribed by similar reactions. The snRNA genes transcribed by RNA polymerase II are distinguished from mRNA-encoding genes by the presence of a proximal sequence element (PSE) rather than a TATA box and the presence of the Integrator complex rather than the Mediator complex (reviewed in Egloff et al. 2008, Jawdeker and Henry 2008).The snRNA genes are among the most rapidly transcribed genes in the genome. The 5' transcribed region of the U2 snRNA gene is largely single-stranded during interphase and metaphase (Pavelitz et al. 2008) and chromatin within the transcribed region is cleared of nucleosomes (O'Reilly et al. 2014). Transcriptional activation of the RNA polymerase II transcribed snRNA genes begins with binding of transcription factors to the distal sequence element (DSE) of the promoter (reviewed in Hernandez 2001, Egloff et al. 2008, Jawdeker and Henry 2008). The factors, which include POU2F1 (Oct-1), POU2F2 (Oct-2), ZNF143 (Staf) and Sp1, promote binding of the SNAPc complex (also known as PTF and PBP) to the PSE. SNAPc helps clear the gene of nucleosomes (O'Reilly et al. 2014) and recruits initiation factors (TFIIA, TFIIB, TFIIE, TFIIF, and snTAFc:TBP) which recruit RNA polymerase II. Phosphorylation of the C-terminal domain (CTD) of RNA polymerase II (reviewed in Egloff and Murphy 2008) by CDK7 recruits RPAP2 and the Integrator complex, which is required for later processing of the 3' end of the pre-snRNA transcript (reviewed in Chen and Wagner 2010, Baillat and Wagner 2015). The Little Elongation Complex (LEC) also appears to bind around the time of transcription initiation (Hu et al. 2013). As transcription proceeds, RPAP2 dephosphorylates serine-5 and P-TEFb phosphorylates serine-2 of the CTD. As transcription reaches the end of the snRNA gene serine-7 of the CTD is phosphorylated. These marks serve to bind protein complexes and are required for 3' processing of the pre-snRNA (reviewed in Egloff and Murphy 2008). After transcription proceeds through the conserved 3' processing sequence of the pre-snRNA the Integrator complex cleaves the pre-snRNA. Transcription then terminates downstream in a less well characterized reaction that requires elements of the polyadenylation system
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ASB6 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID BRCA1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID CCT5 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID CEP120 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct CNTRL Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct CPNE2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID DNM2 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID DXO Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID EHBP1 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID EIF4A2 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID FGFR1OP Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct G3BP1 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct GPN1 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID GPN3 Affinity Capture-MS physical 17643375 , 26186194 , 28514442 , (Europe PMC )NA BioGRID GTF3C3 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID HELLS Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID HNRNPL Affinity Capture-RNA physical 28611215 , (Europe PMC )NA BioGRID INTS1 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID INTS3 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID INTS4 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID INTS7 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID ITCH Reconstituted Complex physical 16055720 , (Europe PMC )NA BioGRID KHDRBS2 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID KHDRBS3 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID LMO2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LRCH2 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID MED1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MED17 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID MED18 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MED19 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 15175163 , 26186194 , (Europe PMC )0.35 BioGRID, IntAct MED21 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MED24 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID MED4 Affinity Capture-MS, Proximity Label-MS physical 17643375 , 25281560 , (Europe PMC )NA BioGRID NEDD4 Reconstituted Complex physical 16055720 , (Europe PMC )NA BioGRID NELFE Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID OFD1 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct PDRG1 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID PIH1D1 Affinity Capture-MS, anti tag coimmunoprecipitation, two hybrid array, two hybrid prey pooling approach association, physical, physical association 17643375 , 24656813 , 26186194 , 28514442 , (Europe PMC )0.62 BioGRID, IntAct POLR2A Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 17643375 , 24997600 , (Europe PMC )0.35 BioGRID, IntAct POLR2B Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID POLR2C Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID POLR2D Affinity Capture-MS physical 17643375 , 28514442 , (Europe PMC )NA BioGRID POLR2E Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID POLR2F Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct POLR2G Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 17643375 , 26186194 , 26496610 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct POLR2H Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID POLR2J Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID POLR2M Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID POLR3A Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID POLR3B Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID POLR3E Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID PPP1CA Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID PPP1CC Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PRPF31 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID RFC4 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID RNGTT Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID RPAP3 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID RPRD1B Affinity Capture-MS, anti tag coimmunoprecipitation, isothermal titration calorimetry, pull down association, direct interaction, physical, physical association 24997600 , 26186194 , 28514442 , (Europe PMC )0.59 BioGRID, IntAct RUVBL2 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID RXRG Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID SYDE1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TCP1 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID TOPBP1 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID URI1 Affinity Capture-MS physical 17643375 , 28561026 , (Europe PMC )NA BioGRID UXT Affinity Capture-MS physical 17643375 , 28514442 , (Europe PMC )NA BioGRID WDR92 Affinity Capture-MS physical 28561026 , (Europe PMC )NA BioGRID WWP2 Affinity Capture-MS physical 25071155 , (Europe PMC )NA BioGRID XPO1 Affinity Capture-MS physical 26673895 , (Europe PMC )NA BioGRID YBX1 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID ZFC3H1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZNHIT2 Proximity Label-MS physical 28561026 , (Europe PMC )NA BioGRID
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CNTRL Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct FGFR1OP Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct G3BP1 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct KSR2 anti tag coimmunoprecipitation association 27086506 , (Europe PMC )0.35 IntAct MED19 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 15175163 , 26186194 , (Europe PMC )0.35 BioGRID, IntAct MED26 anti tag coimmunoprecipitation association 15175163 , (Europe PMC )0.35 IntAct NEURL4 anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct OFD1 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct PIH1D1 Affinity Capture-MS, anti tag coimmunoprecipitation, two hybrid array, two hybrid prey pooling approach association, physical, physical association 17643375 , 24656813 , 26186194 , 28514442 , (Europe PMC )0.62 BioGRID, IntAct POLR2A Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 17643375 , 24997600 , (Europe PMC )0.35 BioGRID, IntAct POLR2F Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct POLR2G Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 17643375 , 26186194 , 26496610 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct RPRD1A anti tag coimmunoprecipitation, isothermal titration calorimetry, pull down association, direct interaction, physical association 24997600 , (Europe PMC )0.59 IntAct RPRD1B Affinity Capture-MS, anti tag coimmunoprecipitation, isothermal titration calorimetry, pull down association, direct interaction, physical, physical association 24997600 , 26186194 , 28514442 , (Europe PMC )0.59 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ASB6 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID BRCA1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID CCT5 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID CEP120 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct CNTRL Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct CPNE2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID DNM2 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID DXO Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID EHBP1 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID EIF4A2 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID FGFR1OP Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct G3BP1 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct GPN1 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID GPN3 Affinity Capture-MS physical 17643375 , 26186194 , 28514442 , (Europe PMC )NA BioGRID GTF3C3 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID HELLS Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID HNRNPL Affinity Capture-RNA physical 28611215 , (Europe PMC )NA BioGRID INTS1 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID INTS3 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID INTS4 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID INTS7 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID ITCH Reconstituted Complex physical 16055720 , (Europe PMC )NA BioGRID KHDRBS2 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID KHDRBS3 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID KSR2 anti tag coimmunoprecipitation association 27086506 , (Europe PMC )0.35 IntAct LMO2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LRCH2 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID MED1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MED17 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID MED18 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MED19 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 15175163 , 26186194 , (Europe PMC )0.35 BioGRID, IntAct MED21 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MED24 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID MED26 anti tag coimmunoprecipitation association 15175163 , (Europe PMC )0.35 IntAct MED4 Affinity Capture-MS, Proximity Label-MS physical 17643375 , 25281560 , (Europe PMC )NA BioGRID NEDD4 Reconstituted Complex physical 16055720 , (Europe PMC )NA BioGRID NELFE Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID NEURL4 anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct OFD1 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct PDRG1 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID PIH1D1 Affinity Capture-MS, anti tag coimmunoprecipitation, two hybrid array, two hybrid prey pooling approach association, physical, physical association 17643375 , 24656813 , 26186194 , 28514442 , (Europe PMC )0.62 BioGRID, IntAct POLR2A Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 17643375 , 24997600 , (Europe PMC )0.35 BioGRID, IntAct POLR2B Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID POLR2C Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID POLR2D Affinity Capture-MS physical 17643375 , 28514442 , (Europe PMC )NA BioGRID POLR2E Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID POLR2F Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct POLR2G Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 17643375 , 26186194 , 26496610 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct POLR2H Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID POLR2J Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID POLR2M Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID POLR3A Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID POLR3B Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID POLR3E Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID PPP1CA Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID PPP1CC Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PRPF31 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID RFC4 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID RNGTT Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID RPAP3 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID RPRD1A anti tag coimmunoprecipitation, isothermal titration calorimetry, pull down association, direct interaction, physical association 24997600 , (Europe PMC )0.59 IntAct RPRD1B Affinity Capture-MS, anti tag coimmunoprecipitation, isothermal titration calorimetry, pull down association, direct interaction, physical, physical association 24997600 , 26186194 , 28514442 , (Europe PMC )0.59 BioGRID, IntAct RUVBL2 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID RXRG Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID SYDE1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TCP1 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID TOPBP1 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID URI1 Affinity Capture-MS physical 17643375 , 28561026 , (Europe PMC )NA BioGRID UXT Affinity Capture-MS physical 17643375 , 28514442 , (Europe PMC )NA BioGRID WDR92 Affinity Capture-MS physical 28561026 , (Europe PMC )NA BioGRID WWP2 Affinity Capture-MS physical 25071155 , (Europe PMC )NA BioGRID XPO1 Affinity Capture-MS physical 26673895 , (Europe PMC )NA BioGRID YBX1 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID ZFC3H1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZNHIT2 Proximity Label-MS physical 28561026 , (Europe PMC )NA BioGRID