Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
PTPRH
Gene Name  | PTPRH (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | PTPRH, SAP1 | |
| Protein Name | PTPRH |
|
| Alternative Name(s) |
Receptor-type tyrosine-protein phosphatase H;R-PTP-H;3.1.3.48;Stomach cancer-associated protein tyrosine phosphatase 1;SAP-1;Transmembrane-type protein-tyrosine phosphatase type H; | |
| EntrezGene ID | 5794 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q9HD43 (protein sequence) | |
| Enzyme Class | EC 3.1.3.48 (BRENDA ) | |
| Molecular Weight | 122353 Dalton | |
| Protein Length | 1115 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000080031 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: Class I Cys-based PTPs --> Family: R-PTP | Historic class: Class I Cys-based PTPs --> Classical PTPs --> Receptor-type PTPs (R-PTPs) | CATH ID: 3.90.190.10 | SCOP Fold: CC1 | |
| Phosphatase activity | active | Catalytic signature motif: HCSAGVGR | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cell projection, microvillus membrane Apical cell membrane Cytoplasm Note=Colocalizes with CEACAM20 at the apical brush border ofintestinal cells | |||
| Function (UniProt annotation) | |||
| Protein phosphatase that may contribute to contactinhibition of cell growth and motility by mediating thedephosphorylation of focal adhesion-associated substrates and thusnegatively regulating integrin-promoted signaling processesInduces apoptotic cell death by at least two distinct mechanisms:inhibition of cell survival signaling mediated by PI 3-kinase,Akt, and ILK and activation of a caspase-dependent proapoptoticpathway Inhibits the basal activity of LCK and its activation inresponse to TCR stimulation and TCR-induced activation of MAPkinase and surface expression of CD69 Inhibits TCR-inducedtyrosine phosphorylation of LAT and ZAP70 Inhibits both basalactivity of DOK1 and its CD2-induced tyrosine phosphorylationInduces dephosphorylation of BCAR1, focal adhesion kinase and SRCReduces migratory activity of activity of Jurkat cells Reducestyrosine phosphorylation of CEACAM20 and thereby contributes tosuppress the intestinal immune response CEACAM20 (By similarity) | |||
| Catalytic Activity (UniProt annotation) | |||
| Protein tyrosine phosphate + H(2)O = proteintyrosine + phosphate | |||
| Protein Sequence | |||
| MAGAGGGLGVWGNLVLLGLCSWTGARAPAPNPGRNLTVETQTTSSISLSWEVPDGLDSQNSNYWVQCTGDGGTTETRNTT ATNVTVDGLGPGSLYTCSVWVEKDGVNSSVGTVTTATAPNPVRNLRVEAQTNSSIALTWEVPDGPDPQNSTYGVEYTGDG GRAGTRSTAHTNITVDGLEPGCLYAFSMWVGKNGINSSRETRNATTAHNPVRNLRVEAQTTSSISLSWEVPDGTDPQNST YCVQCTGDGGRTETRNTTDTRVTVDGLGPGSLYTCSVWVEKDGVNSSVEIVTSATAPNPVRNLTVEAQTNSSIALTWEVP DGPDPQNSTYGVEYTGDGGRAGTRSTAHTNITVDRLEPGCLYVFSVWVGKNGINSSRETRNATTAPNPVRNLHMETQTNS SIALCWEVPDGPYPQDYTYWVEYTGDGGGTETRNTTNTSVTAERLEPGTLYTFSVWAEKNGARGSRQNVSISTVPNAVTS LSKQDWTNSTIALRWTAPQGPGQSSYSYWVSWVREGMTDPRTQSTSGTDITLKELEAGSLYHLTVWAERNEVRGYNSTLT AATAPNEVTDLQNETQTKNSVMLWWKAPGDPHSQLYVYWVQWASKGHPRRGQDPQANWVNQTSRTNETWYKVEALEPGTL YNFTVWAERNDVASSTQSLCASTYPDTVTITSCVSTSAGYGVNLIWSCPQGGYEAFELEVGGQRGSQDRSSCGEAVSVLG LGPARSYPATITTIWDGMKVVSHSVVCHTESAGVIAGAFVGILLFLILVGLLIFFLKRRNKKKQQKPELRDLVFSSPGDI PAEDFADHVRKNERDSNCGFADEYQQLSLVGHSQSQMVASASENNAKNRYRNVLPYDWSRVPLKPIHEEPGSDYINASFM PGLWSPQEFIATQGPLPQTVGDFWRLVWEQQSHTLVMLTNCMEAGRVKCEHYWPLDSQPCTHGHLRVTLVGEEVMENWTV RELLLLQVEEQKTLSVRQFHYQAWPDHGVPSSPDTLLAFWRMLRQWLDQTMEGGPPIVHCSAGVGRTGTLIALDVLLRQL QSEGLLGPFSFVRKMRESRPLMVQTEAQYVFLHQCILRFLQQSAQAPAEKEVPYEDVENLIYENVAAIQAHKLEV |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0005001 | F:transmembrane receptor protein tyrosine phosphatase activity |
| GO:0005737 | C:cytoplasm |
| GO:0005887 | C:integral component of plasma membrane |
| GO:0006470 | P:protein dephosphorylation |
| GO:0006915 | P:apoptotic process |
| GO:0016324 | C:apical plasma membrane |
| GO:0031528 | C:microvillus membrane |
