Top PTPRD
Localization (UniProt annotation) Membrane; Single-pass type I membraneprotein Function (UniProt annotation) Can bidirectionally induce pre- and post-synapticdifferentiation of neurons by mediating interaction with IL1RAPand IL1RAPL1 trans-synaptically Involved in pre-synapticdifferentiation through interaction with SLITRK2 Catalytic Activity (UniProt annotation) Protein tyrosine phosphate + H(2)O = proteintyrosine + phosphate Protein Sequence MVHVARLLLLLLTFFLRTDAETPPRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGS
VLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLREDQIPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWF
KDFLPVDTSNNNGRIKQLRSESIGGTPIRGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRELREVRRVPPRFSI
PPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPEDDMPIGRNVLELNDVRQSANYTCVAMSTLGVIEAIAQITVK
ALPKPPGTPVVTESTATSITLTWDSGNPEPVSYYIIQHKPKNSEELYKEIDGVATTRYSVAGLSPYSDYEFRVVAVNNIG
RGPPSEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIG
NLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGVPGQPLNFKAEPESETSILLSWTPPRSDTIANYELVYKDGEHGEEQ
RITIEPGTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEISARTMQSKPSAPPQDISCTSPSSTSILVSWQPPPVEKQNG
IITEYSIKYTAVDGEDDKPHEILGIPSDTTKYLLEQLEKWTEYRITVTAHTDVGPGPESLSVLIRTNEDVPSGPPRKVEV
EAVNSTSVKVSWRSPVPNKQHGQIRGYQVHYVRMENGEPKGQPMLKDVMLADAQWEFDDTTEHDMIISGLQPETSYSLTV
TAYTTKGDGARSKPKLVSTTGAVPGKPRLVINHTQMNTALIQWHPPVDTFGPLQGYRLKFGRKDMEPLTTLEFSEKEDHF
TATDIHKGASYVFRLSARNKVGFGEEMVKEISIPEEVPTGFPQNLHSEGTTSTSVQLSWQPPVLAERNGIITKYTLLYRD
INIPLLPMEQLIVPADTTMTLTGLKPDTTYDVKVRAHTSKGPGPYSPSVQFRTLPVDQVFAKNFHVKAVMKTSVLLSWEI
PENYNSAMPFKILYDDGKMVEEVDGRATQKLIVNLKPEKSYSFVLTNRGNSAGGLQHRVTAKTAPDVLRTKPAFIGKTNL
DGMITVQLPEVPANENIKGYYIIIVPLKKSRGKFIKPWESPDEMELDELLKEISRKRRSIRYGREVELKPYIAAHFDVLP
TEFTLGDDKHYGGFTNKQLQSGQEYVFFVLAVMEHAESKMYATSPYSDPVVSMDLDPQPITDEEEGLIWVVGPVLAVVFI
ICIVIAILLYKRKRAESDSRKSSIPNNKEIPSHHPTDPVELRRLNFQTPGMASHPPIPILELADHIERLKANDNLKFSQE
YESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFW
RMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETHGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWP
DHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTED
QYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMP
YESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPA
ERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPI
SVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFSYRAALEYLGSFDHYAT
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
Download FASTA sequences of PTPRD-substrates in Humans
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-388844 Receptor-type tyrosine-protein phosphatases. Like neurexins, Receptor-like protein tyrosine phosphatases (RPTPs) make trans-synaptic adhesion complexes with multiple postsynaptic binding partners to regulate synapse organization. The type IIa RPTPs include three members, Receptor-type tyrosine-protein phosphatase F (PTPRF) sometimes referred to as leukocyte common antigen-related (LAR), Receptor-type tyrosine-protein phosphatase sigma (PTPRS) and Receptor-type tyrosine-protein phosphatase delta (PTPRD). These proteins contain typical cell adhesion immunoglobulin-like (Ig) and fibronectin III (FNIII) domains, suggesting the involvement of RPTPs in cell-cell and cell-matrix interactions. To date, six different types of postsynaptic organizers for type-IIa RPTPs have been reported: interleukin-1 receptor accessory protein (IL1RAP, IL-1RAcP) (Yoshida et al. 2012), IL-1RAcP-like-1 (IL1RAPL1) (Yoshida et al. 2011), Neurotrophin receptor tyrosine kinase 3 (NTRK3, TrkC) (Takahashi et al. 2011), Leucine-rich repeat-containing protein 4B (LRRC4B, Netrin-G ligand-3, NGL-3) (Woo et al. 2009, Kwon et al. 2010), the Slit- and Trk-like (Slitrk) family proteins (Takahashi et al. 2012, Yim et al. 2013, Yamagata et al. 2015) and the liprins (Serra-Pagès et al. 1998, Dunah et al. 2005) R-HSA-8849932 Synaptic adhesion-like molecules. Recruitment of receptors and ion channels to the postsynaptic membrane is the last step in synapse formation. Many of these proteins interact directly or indirectly with postsynaptic density-95 (PSD95)/Discs large/zona occludens-1 (PDZ) proteins, thus linking them to the postsynaptic scaffold and providing a mechanism for both retaining the protein at the synapse and keeping its proximity to signaling molecules known to associate with PDZ proteins (Wang et al. 2006, Morimura et al. 2006, Ko et al. 2006, Nourry et al. 2003, Kim & Sheng 2004, Montgomery et al. 2004, Sheng and Kim 2011). The synaptic adhesion-like molecules (SALM) family belongs to the superfamily of leucine-rich repeat (LRR)-containing adhesion molecules, alternatively referred to as LRFN (leucine-rich repeat and fibronectin III domain-containing) is synapse adhesion molecule linked to NMDA and AMPA receptors. It includes five known members (SALMs 1-5 or LRFN1-5), which have been implicated in the regulation of neurite outgrowth and branching, and synapse formation and maturation. SALM proteins are distributed to both dendrites and axons in neurons (Ko et al. 2006, Wang et al. 2006, Sebold et al. 2012). The family members, SALM1-SALM5, have a single transmembrane (TM) domain and contain extracellular leucine-rich repeats, an Ig C2 type domain, a fibronectin type III domain, and an intracellular postsynaptic density-95 (PSD-95)/Discs large/zona occludens-1 (PDZ) binding domain, which is present on all members except SALM4 and SALM5 (Ko et al. 2006, Wang et al.2006, Morimura et al. 2006)
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ARHGAP36 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CD83 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID COPG2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID DSC3 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID EGFR Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct FYN Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GPR37 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HADHA Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID HADHB Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID ICOSLG Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IL17RD Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IL20RA Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IL2RG Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID IZUMO1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LILRB4 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LINGO2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LITAF Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LPAR6 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LRRN1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LRRTM2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MILR1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MTNR1A Two-hybrid, ubiquitin reconstruction physical, physical association 26514267 , (Europe PMC )0.37 BioGRID, IntAct MTNR1B Two-hybrid, ubiquitin reconstruction physical, physical association 26514267 , (Europe PMC )0.37 BioGRID, IntAct NLGN3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PCDH20 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PCDHB16 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PCDHGB4 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PIANP Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PMEL Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PPFIA1 Reconstituted Complex, Two-hybrid physical 8524829 , 9624153 , (Europe PMC )NA BioGRID PPFIA2 Two-hybrid physical 9624153 , (Europe PMC )NA BioGRID PPFIA3 Two-hybrid physical 9624153 , (Europe PMC )NA BioGRID PTPRS Affinity Capture-Western, Two-hybrid physical 9566880 , (Europe PMC )NA BioGRID RPL28 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SCN2B Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID STMN4 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TEX45 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TMEM223 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TMEM52B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TPCN2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TPP2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID TRIM25 Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID TRIO Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID ABCG8 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ARHGAP36 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CD83 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID COPG2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID DSC3 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID EGFR Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct FYN Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GPR37 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HADHA Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID HADHB Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID ICOSLG Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IL17RD Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IL20RA Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IL2RG Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID IZUMO1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LILRB4 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LINGO2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LITAF Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LPAR6 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LRRN1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LRRTM2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MILR1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MTNR1A Two-hybrid, ubiquitin reconstruction physical, physical association 26514267 , (Europe PMC )0.37 BioGRID, IntAct MTNR1B Two-hybrid, ubiquitin reconstruction physical, physical association 26514267 , (Europe PMC )0.37 BioGRID, IntAct NLGN3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PCDH20 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PCDHB16 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PCDHGB4 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PIANP Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PMEL Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PPFIA1 Reconstituted Complex, Two-hybrid physical 8524829 , 9624153 , (Europe PMC )NA BioGRID PPFIA2 Two-hybrid physical 9624153 , (Europe PMC )NA BioGRID PPFIA3 Two-hybrid physical 9624153 , (Europe PMC )NA BioGRID PTPRS Affinity Capture-Western, Two-hybrid physical 9566880 , (Europe PMC )NA BioGRID RPL28 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SCN2B Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID STMN4 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TEX45 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TMEM223 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TMEM52B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TPCN2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TPP2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID TRIM25 Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID TRIO Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AURKA anti tag coimmunoprecipitation, protein array direct interaction, physical association 22305495 , (Europe PMC )0.54 IntAct, MINT BMX protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT CSNK1D protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT CSNK1E protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT DDX54 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT EGFR Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct EPHA8 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT IRS1 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT MARK2 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT MDM2 display technology physical association 20195357 , (Europe PMC )0.40 IntAct MTNR1A Two-hybrid, ubiquitin reconstruction physical, physical association 26514267 , (Europe PMC )0.37 BioGRID, IntAct MTNR1B Two-hybrid, ubiquitin reconstruction physical, physical association 26514267 , (Europe PMC )0.37 BioGRID, IntAct NEK1 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT NEK2 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT NEK6 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT PAK6 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT PLK1 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT PTPRD tox-r dimerization assay association 15978577 , (Europe PMC )0.31 IntAct, MINT SLAIN2 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT SMTNL2 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT TBK1 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT TSSK2 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT ABLIM1 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT AURKA anti tag coimmunoprecipitation, protein array direct interaction, physical association 22305495 , (Europe PMC )0.54 IntAct, MINT BMX protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT CSNK1D protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT CSNK1E protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT DDX54 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT EGFR Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct EPHA8 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT IRS1 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT MARK2 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT MDM2 display technology physical association 20195357 , (Europe PMC )0.40 IntAct MTNR1A Two-hybrid, ubiquitin reconstruction physical, physical association 26514267 , (Europe PMC )0.37 BioGRID, IntAct MTNR1B Two-hybrid, ubiquitin reconstruction physical, physical association 26514267 , (Europe PMC )0.37 BioGRID, IntAct NEK1 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT NEK2 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT NEK6 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT PAK6 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT PLK1 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT PTPRD tox-r dimerization assay association 15978577 , (Europe PMC )0.31 IntAct, MINT SLAIN2 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT SMTNL2 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT TBK1 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT TSSK2 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AURKA anti tag coimmunoprecipitation, protein array direct interaction, physical association 22305495 , (Europe PMC )0.54 IntAct, MINT BMX protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT CSNK1D protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT CSNK1E protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT DDX54 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT EPHA8 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT IRS1 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT MARK2 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT NEK1 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT NEK2 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT NEK6 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT PAK6 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT PLK1 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT PTPRD tox-r dimerization assay association 15978577 , (Europe PMC )0.31 IntAct, MINT SLAIN2 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT SMTNL2 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT TBK1 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT TSSK2 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT ABLIM1 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT AURKA anti tag coimmunoprecipitation, protein array direct interaction, physical association 22305495 , (Europe PMC )0.54 IntAct, MINT BMX protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT CSNK1D protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT CSNK1E protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT DDX54 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT EPHA8 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT IRS1 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT MARK2 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT NEK1 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT NEK2 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT NEK6 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT PAK6 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT PLK1 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT PTPRD tox-r dimerization assay association 15978577 , (Europe PMC )0.31 IntAct, MINT SLAIN2 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT SMTNL2 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT TBK1 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT TSSK2 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABLIM1 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT ARHGAP36 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID AURKA anti tag coimmunoprecipitation, protein array direct interaction, physical association 22305495 , (Europe PMC )0.54 IntAct, MINT BMX protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT CD83 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID COPG2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID CSNK1D protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT CSNK1E protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT DDX54 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT DSC3 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID EGFR Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct EPHA8 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT FYN Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GPR37 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HADHA Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID HADHB Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID ICOSLG Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IL17RD Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IL20RA Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IL2RG Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID IRS1 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT IZUMO1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LILRB4 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LINGO2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LITAF Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LPAR6 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LRRN1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LRRTM2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MARK2 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT MDM2 display technology physical association 20195357 , (Europe PMC )0.40 IntAct MILR1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MTNR1A Two-hybrid, ubiquitin reconstruction physical, physical association 26514267 , (Europe PMC )0.37 BioGRID, IntAct MTNR1B Two-hybrid, ubiquitin reconstruction physical, physical association 26514267 , (Europe PMC )0.37 BioGRID, IntAct NEK1 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT NEK2 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT NEK6 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT NLGN3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PAK6 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT PCDH20 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PCDHB16 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PCDHGB4 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PIANP Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PLK1 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT PMEL Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PPFIA1 Reconstituted Complex, Two-hybrid physical 8524829 , 9624153 , (Europe PMC )NA BioGRID PPFIA2 Two-hybrid physical 9624153 , (Europe PMC )NA BioGRID PPFIA3 Two-hybrid physical 9624153 , (Europe PMC )NA BioGRID PTPRD tox-r dimerization assay association 15978577 , (Europe PMC )0.31 IntAct, MINT PTPRS Affinity Capture-Western, Two-hybrid physical 9566880 , (Europe PMC )NA BioGRID RPL28 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SCN2B Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SLAIN2 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT SMTNL2 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT STMN4 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TBK1 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT TEX45 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TMEM223 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TMEM52B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TPCN2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TPP2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID TRIM25 Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID TRIO Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID TSSK2 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT ABCG8 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ABLIM1 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT ARHGAP36 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID AURKA anti tag coimmunoprecipitation, protein array direct interaction, physical association 22305495 , (Europe PMC )0.54 IntAct, MINT BMX protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT CD83 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID COPG2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID CSNK1D protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT CSNK1E protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT DDX54 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT DSC3 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID EGFR Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct EPHA8 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT FYN Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GPR37 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HADHA Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID HADHB Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID ICOSLG Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IL17RD Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IL20RA Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IL2RG Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID IRS1 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT IZUMO1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LILRB4 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LINGO2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LITAF Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LPAR6 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LRRN1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LRRTM2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MARK2 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT MDM2 display technology physical association 20195357 , (Europe PMC )0.40 IntAct MILR1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MTNR1A Two-hybrid, ubiquitin reconstruction physical, physical association 26514267 , (Europe PMC )0.37 BioGRID, IntAct MTNR1B Two-hybrid, ubiquitin reconstruction physical, physical association 26514267 , (Europe PMC )0.37 BioGRID, IntAct NEK1 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT NEK2 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT NEK6 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT NLGN3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PAK6 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT PCDH20 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PCDHB16 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PCDHGB4 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PIANP Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PLK1 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT PMEL Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PPFIA1 Reconstituted Complex, Two-hybrid physical 8524829 , 9624153 , (Europe PMC )NA BioGRID PPFIA2 Two-hybrid physical 9624153 , (Europe PMC )NA BioGRID PPFIA3 Two-hybrid physical 9624153 , (Europe PMC )NA BioGRID PTPRD tox-r dimerization assay association 15978577 , (Europe PMC )0.31 IntAct, MINT PTPRS Affinity Capture-Western, Two-hybrid physical 9566880 , (Europe PMC )NA BioGRID RPL28 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SCN2B Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SLAIN2 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT SMTNL2 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT STMN4 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TBK1 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT TEX45 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TMEM223 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TMEM52B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TPCN2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TPP2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID TRIM25 Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID TRIO Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID TSSK2 protein array direct interaction 22305495 , (Europe PMC )0.44 IntAct, MINT
Statistics
