Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
PTPN20
Gene Name  | PTPN20 (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | PTPN20 , PTPN20A, PTPN20B | |
| Protein Name | PTPN20 |
|
| Alternative Name(s) |
Tyrosine-protein phosphatase non-receptor type 20;hPTPN20;3.1.3.48; | |
| EntrezGene ID | 26095 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q4JDL3 (protein sequence) | |
| Enzyme Class | EC 3.1.3.48 (BRENDA ) | |
| Molecular Weight | 48423 Dalton | |
| Protein Length | 420 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000204179 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: Class I Cys-based PTPs --> Family: NR-PTP | Historic class: Class I Cys-based PTPs --> Classical PTPs --> Non-receptor type PTPs (NR-PTPs) | CATH ID: 3.90.190.10 | SCOP Fold: NA | |
| Phosphatase activity | active | Catalytic signature motif: HCSAGIGR | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Nucleus Cytoplasm Cytoplasm, cytoskeleton,microtubule organizing center, centrosome Note=Colocalizes with themicrotubule-organizing center and intracellular membranecompartments | |||
| Function (UniProt annotation) | |||
| Tyrosine-protein phosphatase targeted to sites of actinpolymerization in response of varied extracellular stimuli Hastyrosine phosphatase activity towards various tyrosylphosphorylated substrates | |||
| Catalytic Activity (UniProt annotation) | |||
| Protein tyrosine phosphate + H(2)O = proteintyrosine + phosphate | |||
| Protein Sequence | |||
| MSSPRDFRAEPVNDYEGNDSEAEDLNFRETLPSSSQENTPRSKVFENKVNSEKVKLSLRNFPHNDYEDVFEEPSESGSDP SMWTARGPFRRDRWSSEDEEAAGPSQALSPLLSDTRKIVSEGELDQLAQIRPLIFNFHEQTAIKDCLKILEEKTAAYDIM QEFMALELKNLPGEFNSGNQPSNREKNRYRDILPYDSTRVPLGKSKDYINASYIRIVNCGEEYFYIATQGPLLSTIDDFW QMVLENNSNVIAMITREIEGGIIKCYHYWPISLKKPLELKHFRVFLENYQILQYFIIRMFQVVEKSTGTSHSVKQLQFTK WPDHGTPASADSFIKYIRYARKSHLTGPMVVHCSAGIGRTGVFLCVDVVFCAIVKNCSFNIMDIVAQMREQRSGMVQTKE QYHFCYDIVLEVLRKLLTLD |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0004725 | F:protein tyrosine phosphatase activity |
| GO:0005654 | C:nucleoplasm |
| GO:0005737 | C:cytoplasm |
| GO:0005815 | C:microtubule organizing center |
| GO:0005874 | C:microtubule |
| GO:0071345 | P:cellular response to cytokine stimulus |