Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
PPM1L
Gene Name  | PPM1L (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | PPM1L, PP2CE | |
| Protein Name | PPM1L |
|
| Alternative Name(s) |
Protein phosphatase 1L;3.1.3.16;Protein phosphatase 1-like;Protein phosphatase 2C isoform epsilon;PP2C-epsilon; | |
| EntrezGene ID | 151742 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q5SGD2 (protein sequence) | |
| Enzyme Class | EC 3.1.3.16 (BRENDA ) | |
| Molecular Weight | 41053 Dalton | |
| Protein Length | 360 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000163590 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: PPM | Historic class: PSTPs --> PP2C | CATH ID: 3.60.40.10 | SCOP Fold: PPM | |
| Phosphatase activity | active | Catalytic signature motif: unknown | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Membrane | |||
| Function (UniProt annotation) | |||
| Acts as a suppressor of the SAPK signaling pathways byassociating with and dephosphorylating MAP3K7/TAK1 and MAP3K5, andby attenuating the association between MAP3K7/TAK1 and MAP2K4 orMAP2K6 | |||
| Catalytic Activity (UniProt annotation) | |||
| [a protein]-serine/threonine phosphate + H(2)O= [a protein]-serine/threonine + phosphate | |||
| Protein Sequence | |||
| MIEDTMTLLSLLGRIMRYFLLRPETLFLLCISLALWSYFFHTDEVKTIVKSSRDAVKMVKGKVAEIMQNDRLGGLDVLEA EFSKTWEFKNHNVAVYSIQGRRDHMEDRFEVLTDLANKTHPSIFGIFDGHGGETAAEYVKSRLPEALKQHLQDYEKDKEN SVLSYQTILEQQILSIDREMLEKLTVSYDEAGTTCLIALLSDKDLTVANVGDSRGVLCDKDGNAIPLSHDHKPYQLKERK RIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIPDPDILTFDLDKLQPEFMILASDGLWDAFSNEEAVRFIKER LDEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSKTEEQ |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000165 | P:MAPK cascade |
| GO:0004722 | F:protein serine/threonine phosphatase activity |
| GO:0005789 | C:endoplasmic reticulum membrane |
| GO:0007178 | P:transmembrane receptor protein serine/threonine kinase signaling pathway |
| GO:0016021 | C:integral component of membrane |
| GO:0030148 | P:sphingolipid biosynthetic process |
| GO:0046872 | F:metal ion binding |
| GO:0070062 | C:extracellular exosome |
