Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
PHLPP2
Gene Name  | PHLPP2 (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | PHLPP2, KIAA0931, PHLPPL | |
| Protein Name | PHLPP2 |
|
| Alternative Name(s) |
PH domain leucine-rich repeat-containing protein phosphatase 2;3.1.3.16;PH domain leucine-rich repeat-containing protein phosphatase-like;PHLPP-like; | |
| EntrezGene ID | 23035 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q6ZVD8 (protein sequence) | |
| Enzyme Class | EC 3.1.3.16 (BRENDA ) | |
| Molecular Weight | 146751 Dalton | |
| Protein Length | 1323 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000040199 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: PPM | Historic class: PSTPs --> PPM --> PP2C | CATH ID: 3.60.40.10 | SCOP Fold: PPM | |
| Phosphatase activity | active | Catalytic signature motif: unknown | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm Membrane; Peripheral membraneprotein Nucleus Note=In colorectal cancer tissue, expression isconcentrated in the cytoplasm and nucleus | |||
| Function (UniProt annotation) | |||
| Protein phosphatase involved in regulation of Akt andPKC signaling Mediates dephosphorylation in the C-terminal domainhydrophobic motif of members of the AGC Ser/Thr protein kinasefamily; specifically acts on 'Ser-473' of AKT1, 'Ser-660' of PRKCBisoform beta-II and 'Ser-657' of PRKCA Akt regulates the balancebetween cell survival and apoptosis through a cascade thatprimarily alters the function of transcription factors thatregulate pro- and antiapoptotic genes Dephosphorylation of 'Ser-473' of Akt triggers apoptosis and decreases cell proliferationAlso controls the phosphorylation of AKT3 Dephosphorylates STK4on 'Thr-387' leading to STK4 activation and apoptosis(PubMed:20513427) Dephosphorylates RPS6KB1 and is involved inregulation of cap-dependent translation (PubMed:21986499)Inhibits cancer cell proliferation and may act as a tumorsuppressor Dephosphorylation of PRKCA and PRKCB leads to theirdestabilization and degradation Dephosphorylates RAF1 inhibitingits kinase activity (PubMed:24530606) | |||
| Catalytic Activity (UniProt annotation) | |||
| [a protein]-serine/threonine phosphate + H(2)O= [a protein]-serine/threonine + phosphate | |||
| Protein Sequence | |||
| MKRNGSRNCLNRRSRFGSRERDWLREDVKRGCVYLYGADTTTATTTTTTSSSSSSSSSSSDLHLVLCTVETPASEICAGE GRESLYLQLHGDLVRRLEPTERPLQIVYDYLSRLGFDDPVRIQEEATNPDLGCMIRFYGEKPCHMDRLDRILLSGIYNVR KGKTQLHKWAERLVVLCGTCLIVSSVKDCQTGKMHILPLVGGKIEEVKRRQYSLAFSSAGAQAQTYHVSFETLAEYQRWQ RQASKVVSQRISTVDLSCYSLEEVPEHLFYSQDITYLNLRHNFMQLERPGGLDTLYKFSQLKGLNLSHNKLGLFPILLCE ISTLTELNLSCNGFHDLPSQIGNLLNLQTLCLDGNFLTTLPEELGNLQQLSSLGISFNNFSQIPEVYEKLTMLDRVVMAG NCLEVLNLGVLNRMNHIKHVDLRMNHLKTMVIENLEGNKHITHVDLRDNRLTDLDLSSLCSLEQLHCGRNQLRELTLSGF SLRTLYASSNRLTAVNVYPVPSLLTFLDLSRNLLECVPDWACEAKKIEVLDVSYNLLTEVPVRILSSLSLRKLMLGHNHV QNLPTLVEHIPLEVLDLQHNALTRLPDTLFSKALNLRYLNASANSLESLPSACTGEESLSMLQLLYLTNNLLTDQCIPVL VGHLHLRILHLANNQLQTFPASKLNKLEQLEELNLSGNKLKTIPTTIANCKRLHTLVAHSNNISIFPEILQLPQIQFVDL SCNDLTEILIPEALPATLQDLDLTGNTNLVLEHKTLDIFSHITTLKIDQKPLPTTDSTVTSTFWSHGLAEMAGQRNKLCV SALAMDSFAEGVGAVYGMFDGDRNEELPRLLQCTMADVLLEEVQQSTNDTVFMANTFLVSHRKLGMAGQKLGSSALLCYI RPDTADPASSFSLTVANVGTCQAVLCRGGKPVPLSKVFSLEQDPEEAQRVKDQKAIITEDNKVNGVTCCTRMLGCTYLYP WILPKPHISSTPLTIQDELLILGNKALWEHLSYTEAVNAVRHVQDPLAAAKKLCTLAQSYGCQDNVGAMVVYLNIGEEGC TCEMNGLTLPGPVGFASTTTIKDAPKPATPSSSSGIASEFSSEMSTSEVSSEVGSTASDEHNAGGLDTALLPRPERRCSL HPTPTSGLFQRQPSSATFSSNQSDNGLDSDDDQPVEGVITNGSKVEVEVDIHCCRGRDLENSPPLIESSPTLCSEEHARG SCFGIRRQNSVNSGMLLPMSKDRMELQKSPSTSCLYGKKLSNGSIVPLEDSLNLIEVATEVPKRKTGYFAAPTQMEPEDQ FVVPHDLEEEVKEQMKQHQDSRLEPEPHEEDRTEPPEEFDTAL |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0001917 | C:photoreceptor inner segment |
| GO:0004722 | F:protein serine/threonine phosphatase activity |
| GO:0005634 | C:nucleus |
| GO:0005737 | C:cytoplasm |
| GO:0005829 | C:cytosol |
| GO:0006470 | P:protein dephosphorylation |
| GO:0007165 | P:signal transduction |
| GO:0021766 | P:hippocampus development |
| GO:0042622 | C:photoreceptor outer segment membrane |
| GO:0046872 | F:metal ion binding |
