Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
NT5M
Gene Name  | NT5M (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | NT5M, DNT2 | |
| Protein Name | NT5M |
|
| Alternative Name(s) |
5'(3')-deoxyribonucleotidase, mitochondrial;5',3'-nucleotidase, mitochondrial;3.1.3.-;Deoxy-5'-nucleotidase 2;dNT-2; | |
| EntrezGene ID | 56953 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q9NPB1 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 25862 Dalton | |
| Protein Length | 228 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000205309 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: HAD | Historic class: 5'(3')-deoxyribonucleotidase | CATH ID: 3.40.50.1000 | SCOP Fold: HAD | |
| Phosphatase activity | active | Catalytic signature motif: unknown | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Mitochondrion | |||
| Function (UniProt annotation) | |||
| Dephosphorylates specifically the 5' and 2'(3')-phosphates of uracil and thymine deoxyribonucleotides, and soprotects mitochondrial DNA replication from excess dTTP Has onlymarginal activity towards dIMP and dGMP | |||
| Catalytic Activity (UniProt annotation) | |||
| NA | |||
| Protein Sequence | |||
| MIRLGGWCARRLCSAAVPAGRRGAAGGLGLAGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQ YGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIV LTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRPC |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000166 | F:nucleotide binding |
| GO:0005739 | C:mitochondrion |
| GO:0005759 | C:mitochondrial matrix |
| GO:0006260 | P:DNA replication |
| GO:0008252 | F:nucleotidase activity |
| GO:0008253 | F:5'-nucleotidase activity |
| GO:0009223 | P:pyrimidine deoxyribonucleotide catabolic process |
| GO:0046079 | P:dUMP catabolic process |
| GO:0046135 | P:pyrimidine nucleoside catabolic process |
| GO:0046872 | F:metal ion binding |
