Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
NT5C3B
Gene Name  | NT5C3B (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | NT5C3B, NT5C3L | |
| Protein Name | NT5C3B |
|
| Alternative Name(s) |
7-methylguanosine phosphate-specific 5'-nucleotidase;7-methylguanosine nucleotidase;3.1.3.91;Cytosolic 5'-nucleotidase 3B;Cytosolic 5'-nucleotidase III-like protein;cN-III-like protein;3.1.3.5;N(7)-methylguanylate 5'-phosphatase; | |
| EntrezGene ID | 115024 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q969T7 (protein sequence) | |
| Enzyme Class | EC 3.1.3.91 3.1.3.5 (BRENDA ) | |
| Molecular Weight | 34389 Dalton | |
| Protein Length | 300 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000141698 (Ensembl) | | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: HAD | Historic class: Pyrimidine 5'-nucleotidase family | CATH ID: 3.40.50.1000 | SCOP Fold: HAD | |
| Phosphatase activity | active | Catalytic signature motif: unknown | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm | |||
| Function (UniProt annotation) | |||
| Specifically hydrolyzes 7-methylguanosine monophosphate(m(7)GMP) to 7-methylguanosine and inorganic phosphate(PubMed:23223233, PubMed:24603684) The specific activity form(7)GMP may protect cells against undesired salvage of m(7)GMP andits incorporation into nucleic acids (PubMed:23223233) Also hasweak activity for CMP (PubMed:23223233, PubMed:24603684) UMP andpurine nucleotides are poor substrates (PubMed:23223233) | |||
| Catalytic Activity (UniProt annotation) | |||
| N(7)-methyl-GMP + H(2)O = N(7)-methyl-guanosine + phosphate CMP + H(2)O = cytidine + phosphate A 5'-ribonucleotide + H(2)O = a ribonucleoside+ phosphate | |||
| Protein Sequence | |||
| MAEEVSTLMKATVLMRQPGRVQEIVGALRKGGGDRLQVISDFDMTLSRFAYNGKRCPSSYNILDNSKIISEECRKELTAL LHHYYPIEIDPHRTVKEKLPHMVEWWTKAHNLLCQQKIQKFQIAQVVRESNAMLREGYKTFFNTLYHNNIPLFIFSAGIG DILEEIIRQMKVFHPNIHIVSNYMDFNEDGFLQGFKGQLIHTYNKNSSACENSGYFQQLEGKTNVILLGDSIGDLTMADG VPGVQNILKIGFLNDKVEERRERYMDSYDIVLEKDETLDVVNGLLQHILCQGVQLEMQGP |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000166 | F:nucleotide binding |
| GO:0000287 | F:magnesium ion binding |
| GO:0005829 | C:cytosol |
| GO:0008253 | F:5'-nucleotidase activity |
| GO:0009117 | P:nucleotide metabolic process |
| GO:0043928 | P:exonucleolytic nuclear-transcribed mRNA catabolic process involved in deadenylation-dependent decay |