Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
NT5C1B
Gene Name  | NT5C1B (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | NT5C1B, AIRP, FKSG85 | |
| Protein Name | NT5C1B |
|
| Alternative Name(s) |
Cytosolic 5'-nucleotidase 1B;cN1B;3.1.3.5;Autoimmune infertility-related protein;Cytosolic 5'-nucleotidase IB;cN-IB; | |
| EntrezGene ID | 100526794 93034 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q96P26 (protein sequence) | |
| Enzyme Class | EC 3.1.3.5 (BRENDA ) | |
| Molecular Weight | 68804 Dalton | |
| Protein Length | 610 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000185013 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: HAD | Historic class: 5'-nucleotidase type 3 | CATH ID: NA | SCOP Fold: HAD | |
| Phosphatase activity | active | Catalytic signature motif: unknown | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm | |||
| Function (UniProt annotation) | |||
| Dephosphorylates the 5' and 2'(3')-phosphates ofdeoxyribonucleotides Helps to regulate adenosine levels (Bysimilarity) | |||
| Catalytic Activity (UniProt annotation) | |||
| A 5'-ribonucleotide + H(2)O = a ribonucleoside+ phosphate | |||
| Protein Sequence | |||
| MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQMRRAVNPNHSLRCCPFQGHSSCRRCLCAAEGTALGPCHTI RIYIHMCLLWEQGQQITMMRGSQESSLRKTDSRGYLVRSQWSRISRSPSTKAPSIDEPRSRNTSAKLPSSSTSSRTPSTS PSLHDSSPPPLSGQPSLQPPASPQLPRSLDSRPPTPPEPDPGSRRSTKMQENPEAWAQGIVREIRQTRDSQPLEYSRTSP TEWKSSSQRRGIYPASTQLDRNSLSEQQQQQREDEDDYEAAYWASMRSFYEKNPSCSRPWPPKPKNAITIALSSCALFNM VDGRKIYEQEGLEKYMEYQLTNENVILTPGPAFRFVKALQYVNARLRDLYPDEQDLFDIVLMTNNHAQVGVRLINSVNHY GLLIDRFCLTGGKDPIGYLKAYLTNLYIAADSEKVQEAIQEGIASATMFDGAKDMAYCDTQLRVAFDGDAVLFSDESEHF TKEHGLDKFFQYDTLCESKPLAQGPLKGFLEDLGRLQKKFYAKNERLLCPIRTYLVTARSAASSGARVLKTLRRWGLEID EALFLAGAPKSPILVKIRPHIFFDDHMFHIEGAQRLGSIAAYGFNKKFSS |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000166 | F:nucleotide binding |
| GO:0000287 | F:magnesium ion binding |
| GO:0005634 | C:nucleus |
| GO:0005829 | C:cytosol |
| GO:0006195 | P:purine nucleotide catabolic process |
| GO:0008253 | F:5'-nucleotidase activity |