Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
IMPA1
Gene Name  | IMPA1 (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | IMPA1, IMPA | |
| Protein Name | IMPA1 |
|
| Alternative Name(s) |
Inositol monophosphatase 1;IMP 1;IMPase 1;3.1.3.25;D-galactose 1-phosphate phosphatase;3.1.3.94;Inositol-1(or 4)-monophosphatase 1;Lithium-sensitive myo-inositol monophosphatase A1; | |
| EntrezGene ID | 3612 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P29218 (protein sequence) | |
| Enzyme Class | EC 3.1.3.25 3.1.3.94 (BRENDA ) | |
| Molecular Weight | 30189 Dalton | |
| Protein Length | 277 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000133731 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: adenosine_fructose_inositol-x-phosphatases (AFIxP) | Historic class: Inositol monophosphatase | CATH ID: 3.30.540.10, 3.40.190.80 | SCOP Fold: CP | |
| Phosphatase activity | active | Catalytic signature motif: unknown | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | DisGeNet | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm | |||
| Function (UniProt annotation) | |||
| Responsible for the provision of inositol required forsynthesis of phosphatidylinositol and polyphosphoinositides andhas been implicated as the pharmacological target for lithiumaction in brain Has broad substrate specificity and can use myo-inositol monophosphates, myo-inositol 1,3-diphosphate, myo-inositol 1,4-diphosphate, scyllo-inositol-phosphate, D-galactose1-phosphate, glucose-1-phosphate, glucose-6-phosphate, fructose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates | |||
| Catalytic Activity (UniProt annotation) | |||
| Myo-inositol phosphate + H(2)O = myo-inositol+ phosphate Alpha-D-galactose 1-phosphate + H(2)O = D-galactose + phosphate | |||
| Protein Sequence | |||
| MADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSI LTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLV TELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTG GPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000287 | F:magnesium ion binding |
| GO:0005737 | C:cytoplasm |
| GO:0005829 | C:cytosol |
| GO:0006020 | P:inositol metabolic process |
| GO:0006021 | P:inositol biosynthetic process |
| GO:0006661 | P:phosphatidylinositol biosynthetic process |
| GO:0006796 | P:phosphate-containing compound metabolic process |
| GO:0007165 | P:signal transduction |
| GO:0008934 | F:inositol monophosphate 1-phosphatase activity |
| GO:0030145 | F:manganese ion binding |
| GO:0031403 | F:lithium ion binding |
| GO:0042802 | F:identical protein binding |
| GO:0042803 | F:protein homodimerization activity |
| GO:0043647 | P:inositol phosphate metabolic process |
| GO:0046854 | P:phosphatidylinositol phosphorylation |
| GO:0046855 | P:inositol phosphate dephosphorylation |
| GO:0052832 | F:inositol monophosphate 3-phosphatase activity |
| GO:0052833 | F:inositol monophosphate 4-phosphatase activity |
| GO:0052834 | F:inositol monophosphate phosphatase activity |
