Top
CTDSPL2
Localization (UniProt annotation) N/A Function (UniProt annotation) Probable phosphatase Catalytic Activity (UniProt annotation) NA Protein Sequence MRLRTRKASQQSNQIQTQRTARAKRKYSEVDDSLPSGGEKPSKNETGLLSSIKKFIKGSTPKEERENPSKRSRIERDIDN
NLITSTPRAGEKPNKQISRVRRKSQVNGEAGSYEMTNQHVKQNGKLEDNPSSGSPPRTTLLGTIFSPVFNFFSPANKNGT
SGSDSPGQAVEAEEIVKQLDMEQVDEITTSTTTSTNGAAYSNQAVQVRPSLNNGLEEAEETVNRDIPPLTAPVTPDSGYS
SAHAEATYEEDWEVFDPYYFIKHVPPLTEEQLNRKPALPLKTRSTPEFSLVLDLDETLVHCSLNELEDAALTFPVLFQDV
IYQVYVRLRPFFREFLERMSQMYEIILFTASKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIKDLNILGRDLSKT
IIIDNSPQAFAYQLSNGIPIESWFMDKNDNELLKLIPFLEKLVELNEDVRPHIRDRFRLHDLLPPD
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
Download FASTA sequences of CTDSPL2-substrates in HumansSubstrate Gene Name Substrate UniProt_AC DephosphoSite and sequence (+/-5) Bioassay Type PubMed ID View in Europe PMC Reliability of the interaction POLR2A P24928 Ser-1619,Ser-1623,Ser-1644,Ser-1647,Ser-1658,Ser-1661,Ser-1672,Ser-1675,Ser-1686,Ser-1689,Ser-1700,Ser-1703,Ser-1714,Ser-1717,Ser-1728,Ser-1731,Ser-1763,Ser-1766,Ser-1791,Ser-1794_TSPSYsPTSPS, In vitro 17487459 , Europe PMC
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CDC42BPA Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID CPNE8 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID ELAVL1 Affinity Capture-RNA physical 19322201 , (Europe PMC )NA BioGRID ELOC Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID FBXL19 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct IPP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct JAK1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct KLF16 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct KPNA2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID KPNA3 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID KPNA4 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID KPNB1 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID MED15 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYBL2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NUP153 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID NUP93 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PDIK1L Affinity Capture-MS, two hybrid array, two hybrid prey pooling approach physical, physical association 28514442 , , (Europe PMC )0.49 BioGRID, IntAct PTAR1 Synthetic Lethality genetic 26472760 , (Europe PMC )NA BioGRID RANBP2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID RANGAP1 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID RPL10 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID SCYL1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SLC27A2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct STK35 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CDC42BPA anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct CPNE8 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct FBXL19 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct IPP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct JAK1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct KLF16 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MED15 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYBL2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PDIK1L Affinity Capture-MS, two hybrid array, two hybrid prey pooling approach physical, physical association 28514442 , , (Europe PMC )0.49 BioGRID, IntAct SCYL1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SLC27A2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ATP5F1E Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID CDC42BPA Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID CDC42BPA anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct CPNE8 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID CPNE8 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct ELAVL1 Affinity Capture-RNA physical 19322201 , (Europe PMC )NA BioGRID ELOC Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID FBXL19 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct IPP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct JAK1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct KLF16 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct KPNA2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID KPNA3 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID KPNA4 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID KPNB1 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID MED15 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYBL2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NUP153 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID NUP93 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PDIK1L Affinity Capture-MS, two hybrid array, two hybrid prey pooling approach physical, physical association 28514442 , , (Europe PMC )0.49 BioGRID, IntAct PTAR1 Synthetic Lethality genetic 26472760 , (Europe PMC )NA BioGRID RANBP2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID RANGAP1 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID RPL10 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID SCYL1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SLC27A2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct STK35 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
Unknown S104_ISRVRRKsQVNGEAG , S134_EDNPSSGsPPRTTLL , S161_PANKNGTsGSDSPGQ , S165_NGTSGSDsPGQAVEA , S28_ARAKRKYsEVDDSLP , S33_KYSEVDDsLPSGGEK , S50_KNETGLLsSIKKFIK , S51_NETGLLSsIKKFIKG , S85_IDNNLITsTPRAGEK , T84_DIDNNLItSTPRAGE , T86_DNNLITStPRAGEKP , Y27_TARAKRKySEVDDSL , in vivo 17081983 , 18669648 , 18691976 , 19413330 , 19651622 , 19664995 , 20068231 ,(Europe PMC )HPRD,