- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Deposit Data
- Acknowledgement
- Contact
- Licence
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- Catalytic Site Atlas
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetwoKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- NCI Nature PID
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- PTP-Central
- EKPD
- HuPHo
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last update: 11 Mar, 2019
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last update: 11 Mar, 2019
Top
CDC25B
Gene Name  | CDC25B (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | CDC25B, CDC25HU2 | |
| Protein Name | CDC25B | |
| Alternative Name(s) | M-phase inducer phosphatase 2;3.1.3.48;Dual specificity phosphatase Cdc25B; | |
| EntrezGene ID | 994 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P30305 (protein sequence) | |
| Enzyme Class | EC 3.1.3.48 (BRENDA ) | |
| Molecular Weight | 64987 Dalton | |
| Protein Length | 580 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000101224 (Ensembl) | UCSC | 1000 Genomes | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: Class III Cys-based PTPs --> Family: CDC25 | Historic class: Class III Cys-based PTPs --> CDC25s | CATH ID: 3.40.250.10 | SCOP Fold: CC3 | |
| Phosphatase activity | active | Catalytic signature motif: HCEFSSER | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSite | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm, cytoskeleton, microtubuleorganizing center, centrosome Cytoplasm, cytoskeleton, spindle pole | |||
| Function (UniProt annotation) | |||
| Tyrosine protein phosphatase which functions as adosage-dependent inducer of mitotic progression Required for G2/Mphases of the cell cycle progression and abscission duringcytokinesis in a ECT2-dependent manner Directly dephosphorylatesCDK1 and stimulates its kinase activity The three isoforms seemto have a different level of activity | |||
| Catalytic Activity (UniProt annotation) | |||
| Protein tyrosine phosphate + H(2)O = proteintyrosine + phosphate | |||
| Protein Sequence | |||
| MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASSPVTTLTQTMHDLAGLGSETPKSQVGTLLFR SRSRLTHLSLSRRASESSLSSESSESSDAGLCMDSPSPMDPHMAEQTFEQAIQAASRIIRNEQFAIRRFQSMPVRLLGHS PVLRNITNSQAPDGRRKSEAGSGAASSSGEDKENDGFVFKMPWKPTHPSSTHALAEWASRREAFAQRPSSAPDLMCLSPD RKMEVEELSPLALGRFSLTPAEGDTEEDDGFVDILESDLKDDDAVPPGMESLISAPLVKTLEKEEEKDLVMYSKCQRLFR SPSMPCSVIRPILKRLERPQDRDTPVQNKRRRSVTPPEEQQEAEEPKARVLRSKSLCHDEIENLLDSDHRELIGDYSKAF LLQTVDGKHQDLKYISPETMVALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPCSLDKR VILIFHCEFSSERGPRMCRFIRERDRAVNDYPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRPMNHEAFKDELKTFRLK TRSWAGERSRRELCSRLQDQ |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000086 | P:G2/M transition of mitotic cell cycle |
| GO:0000278 | P:mitotic cell cycle |
| GO:0000922 | C:spindle pole |
| GO:0001556 | P:oocyte maturation |
| GO:0004721 | F:phosphoprotein phosphatase activity |
| GO:0004725 | F:protein tyrosine phosphatase activity |
| GO:0005654 | C:nucleoplasm |
| GO:0005813 | C:centrosome |
| GO:0005829 | C:cytosol |
| GO:0006468 | P:protein phosphorylation |
| GO:0007144 | P:female meiosis I |
| GO:0008284 | P:positive regulation of cell proliferation |
| GO:0019901 | F:protein kinase binding |
| GO:0032467 | P:positive regulation of cytokinesis |
| GO:0045860 | P:positive regulation of protein kinase activity |
| GO:0045931 | P:positive regulation of mitotic cell cycle |
| GO:0051301 | P:cell division |
| GO:1902751 | P:positive regulation of cell cycle G2/M phase transition |
Download FASTA sequences of CDC25B-substrates in Humans
| Substrate Gene Name | Substrate UniProt_AC | DephosphoSite and sequence (+/-5) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| CDK1 | P06493 | Thr-14_KIGEGtYGVVY,, Tyr-15_IGEGTyGVVYK, | In vitro | 8440392, 8617791, | Europe PMC |  |
[Feedback|Contribution]
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| hsa04010 | MAPK signaling pathway | The mitogen-activated protein kinase (MAPK) cascade is a highly conserved module that is involved in various cellular functions, including cell proliferation, differentiation and migration. Mammals express at least four distinctly regulated groups of MAPKs, extracellular signal-related kinases (ERK)-1/2, Jun amino-terminal kinases (JNK1/2/3), p38 proteins (p38alpha/beta/gamma/delta) and ERK5, that are activated by specific MAPKKs: MEK1/2 for ERK1/2, MKK3/6 for the p38, MKK4/7 (JNKK1/2) for the JNKs, and MEK5 for ERK5. Each MAPKK, however, can be activated by more than one MAPKKK, increasing the complexity and diversity of MAPK signalling. Presumably each MAPKKK confers responsiveness to distinct stimuli. For example, activation of ERK1/2 by growth factors depends on the MAPKKK c-Raf, but other MAPKKKs may activate ERK1/2 in response to pro-inflammatory stimuli. |
| hsa04110 | Cell cycle | Mitotic cell cycle progression is accomplished through a reproducible sequence of events, DNA replication (S phase) and mitosis (M phase) separated temporally by gaps known as G1 and G2 phases. Cyclin-dependent kinases (CDKs) are key regulatory enzymes, each consisting of a catalytic CDK subunit and an activating cyclin subunit. CDKs regulate the cell's progression through the phases of the cell cycle by modulating the activity of key substrates. Downstream targets of CDKs include transcription factor E2F and its regulator Rb. Precise activation and inactivation of CDKs at specific points in the cell cycle are required for orderly cell division. Cyclin-CDK inhibitors (CKIs), such as p16Ink4a, p15Ink4b, p27Kip1, and p21Cip1, are involved in the negative regulation of CDK activities, thus providing a pathway through which the cell cycle is negatively regulated.Eukaryotic cells respond to DNA damage by activating signaling pathways that promote cell cycle arrest and DNA repair. In response to DNA damage, the checkpoint kinase ATM phosphorylates and activates Chk2, which in turn directly phosphorylates and activates p53 tumor suppressor protein. p53 and its transcriptional targets play an important role in both G1 and G2 checkpoints. ATR-Chk1-mediated protein degradation of Cdc25A protein phosphatase is also a mechanism conferring intra-S-phase checkpoint activation. |
| hsa04914 | Progesterone-mediated oocyte maturation | Xenopus oocytes are naturally arrested at G2 of meiosis I. Exposure to either insulin/IGF-1 or the steroid hormone progesterone breaks this arrest and induces resumption of the two meiotic division cycles and maturation of the oocyte into a mature, fertilizable egg. This process is termed oocyte maturation. The transition is accompanied by an increase in maturation promoting factor (MPF or Cdc2/cyclin B) which precedes germinal vesicle breakdown (GVBD). Most reports point towards the Mos-MEK1-ERK2 pathway [where ERK is an extracellular signal-related protein kinase, MEK is a MAPK/ERK kinase and Mos is a p42(MAPK) activator] and the polo-like kinase/CDC25 pathway as responsible for the activation of MPF in meiosis, most likely triggered by a decrease in cAMP. |
| hsa05206 | MicroRNAs in cancer | MicroRNA (miRNA) is a cluster of small non-encoding RNA molecules of 21 - 23 nucleotides in length, which controls gene expression post-transcriptionally either via the degradation of target mRNAs or the inhibition of protein translation. Using high-throughput profiling, dysregulation of miRNAs has been widely observed in different stages of cancer. The upregulation (overexpression) of specific miRNAs could lead to the repression of tumor suppressor gene expression, and conversely the downregulation of specific miRNAs could result in an increase of oncogene expression; both these situations induce subsequent malignant effects on cell proliferation, differentiation, and apoptosis that lead to tumor growth and progress. The miRNA signatures of cancer observed in various studies differ significantly. These inconsistencies occur due to the differences in the study populations and methodologies used. This pathway map shows the summarized results from various studies in 9 cancers, each of which is presented in a review article. |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-69273 | Cyclin A/B1/B2 associated events during G2/M transition. | Cell cycle progression is regulated by cyclin-dependent protein kinases at both the G1/S and the G2/M transitions. The G2/M transition is regulated through the phosphorylation of nuclear lamins and histones (reviewed in Sefton, 2001).The two B-type cyclins localize to different regions within the cell and are thought to have specific roles as CDK1-activating subunits (see Bellanger et al., 2007). Cyclin B1 is primarily cytoplasmic during interphase and translocates into the nucleus at the onset of mitosis (Jackman et al., 1995; Hagting et al., 1999). Cyclin B2 colocalizes with the Golgi apparatus and contributes to its fragmentation during mitosis (Jackman et al., 1995; Draviam et al., 2001) |
| R-HSA-69656 | Cyclin A:Cdk2-associated events at S phase entry. | Cyclin A:Cdk2 plays a key role in S phase entry by phosphorylation of proteins including Cdh1, Rb, p21 and p27. During G1 phase of the cell cycle, cyclin A is synthesized and associates with Cdk2. After forming in the cytoplasm, the Cyclin A:Cdk2 complexes are translocated to the nucleus (Jackman et al.,2002). Prior to S phase entry, the activity of Cyclin A:Cdk2 complexes is negatively regulated through Tyr 15 phosphorylation of Cdk2 (Gu et al., 1995) and also by the association of the cyclin kinase inhibitors (CKIs), p27 and p21. Phosphorylation of cyclin-dependent kinases (CDKs) by the CDK-activating kinase (CAK) is required for the activation of the CDK2 kinase activity (Aprelikova et al., 1995). The entry into S phase is promoted by the removal of inhibitory Tyr 15 phosphates from the Cdk2 subunit of Cyclin A:Cdk2 complex by the Cdc25 phosphatases (Blomberg and Hoffmann, 1999) and by SCF(Skp2)-mediated degradation of p27/p21 (see Ganoth et al., 2001). \r\nWhile Cdk2 is thought to play a primary role in regulating entry into S phase, recent evidence indicates that Cdk1 is equally capable of promoting entry into S phase and the initiation of DNA replication (see Bashir and Pagano, 2005). Thus, Cdk1 complexes may also play a significant role at this point in the cell cycle |
| R-HSA-8862803 | Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models. | Post-mitotic neurons do not have an active cell cycle. However, deregulation of Cyclin Dependent Kinase-5 (CDK5) activity in these neurons can aberrantly activate various components of cell cycle leading to neuronal death (Chang et al. 2012). Random activation of cell cycle proteins has been shown to play a key role in the pathogenesis of several neurodegenerative disorders (Yang et al. 2003, Lopes et al. 2009). CDK5 is not activated by the canonical cyclins, but binds to its own specific partners, CDK5R1 and CDK5R2 (aka p35 and p39, respectively) (Tsai et al. 1994, Tang et al. 1995). Expression of p35 is nearly ubiquitous, whereas p39 is largely expressed in the central nervous system. A variety of neurotoxic insults such as beta-amyloid (A-beta), ischemia, excitotoxicity and oxidative stress disrupt the intracellular calcium homeostasis in neurons, thereby leading to the activation of calpain, which cleaves p35 into p25 and p10 (Lee et al. 2000). p25 has a six-fold longer half-life compared to p35 and lacks the membrane anchoring signal, which results in its constitutive activation and mislocalization of the CDK5:p25 complex to the cytoplasm and the nucleus. There, CDK5:p25 is able to access and phosphorylate a variety of atypical targets, triggering a cascade of neurotoxic pathways that culminate in neuronal death. One such neurotoxic pathway involves CDK5-mediated random activation of cell cycle proteins which culminate in neuronal death. Exposure of primary cortical neurons to oligomeric beta-amyloid (1-42) hyper-activates CDK5 due to p25 formation, which in turn phosphorylates CDC25A, CDC25B and CDC25C. CDK5 phosphorylates CDC25A at S40, S116 and S261; CDC25B at S50, T69, S160, S321 and S470; and CDC25C at T48, T67, S122, T130, S168 and S214. CDK5-mediated phosphorylation of CDC25A, CDC25B and CDC25C not only increases their phosphatase activities but also facilitates their release from 14-3-3 inhibitory binding. CDC25A, CDC25B and CDC25C in turn activate CDK1, CDK2 and CDK4 kinases causing neuronal death. Consistent with this mechanism, higher CDC25A, CDC25B and CDC25C activities were observed in human Alzheimer's disease (AD) clinical samples, as compared to age-matched controls |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AFDN | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| AGAP1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| ANKRD34A | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| AR | Reconstituted Complex | physical | 12569365, (Europe PMC) | NA | BioGRID |
| BRSK2 | Biochemical Activity | physical | 15150265, (Europe PMC) | NA | BioGRID |
| BTRC | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Proximity Label-MS, Reconstituted Complex | physical | 15845771, 21807946, 25332235, 25900982, 26091241, 26496610, 27880917, 28514442, (Europe PMC) | NA | BioGRID |
| CALU | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CAMSAP2 | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| CBY1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| CCDC28A | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CCNB1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CDC14A | Affinity Capture-Western, Biochemical Activity | physical | 20956543, (Europe PMC) | NA | BioGRID |
| CDC20 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CDC25B | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CDC5L | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDK1 | Affinity Capture-Western | physical | 11516829, (Europe PMC) | NA | BioGRID |
| CDK16 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| CDK2 | Biochemical Activity, Two-hybrid, two hybrid | physical, physical association | 16191191, 7644510, 9840943, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CDK3 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CDK5 | Affinity Capture-Western, Biochemical Activity | physical | 11516829, 22899714, (Europe PMC) | NA | BioGRID |
| CENPB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CGN | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| CHEK1 | Biochemical Activity, Reconstituted Complex | physical | 9278511, (Europe PMC) | NA | BioGRID |
| CSNK2A1 | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex | physical | 12527891, (Europe PMC) | NA | BioGRID |
| CUL1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| DCLK1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| DENND1A | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| DENND4C | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| DEPDC1B | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| EDC3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| EIF4B | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EIF4E2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| ESR1 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 11689696, (Europe PMC) | NA | BioGRID |
| FAM110A | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| FAM110B | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| FAM53C | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| FBXW11 | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, anti tag coimmunoprecipitation | association, physical, physical association | 19615732, 21807946, 22017875, 25332235, 25515538, 25900982, 26496610, 27432908, 27880917, 28514442, 29150431, (Europe PMC) | 0.35, 0.40 | BioGRID, IntAct |
| FOXM1 | Affinity Capture-Western | physical | 15024056, (Europe PMC) | NA | BioGRID |
| GAB2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| GIGYF1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| HDAC4 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KAT2B | Reconstituted Complex | physical | 11689696, (Europe PMC) | NA | BioGRID |
| KCTD3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KIF13B | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KIF1C | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KRT31 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| KRT35 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| KRT85 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| KSR1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| LIMA1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| LRFN1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| MAGI1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| MAP3K21 | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| MAPK14 | Biochemical Activity, Reconstituted Complex | physical | 11333986, (Europe PMC) | NA | BioGRID |
| MAPK1IP1L | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| MAPK9 | Biochemical Activity | physical | 15629715, (Europe PMC) | NA | BioGRID |
| MAPKAP1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| MAPKAPK2 | Biochemical Activity | physical | 15629715, (Europe PMC) | NA | BioGRID |
| MAST3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| MELK | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, inference by socio-affinity scoring | physical, physical association | 12400006, 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| NADK | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| NAV1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| NF1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| PGR | Reconstituted Complex | physical | 11689696, (Europe PMC) | NA | BioGRID |
| PHB2 | Affinity Capture-MS | physical | 17353931, (Europe PMC) | NA | BioGRID |
| PHLDB2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| PLEKHA5 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| PLEKHA7 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| PPM1F | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| PPM1H | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| PRMT1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| PSME3 | Affinity Capture-MS, two hybrid array, two hybrid prey pooling approach | physical, physical association | 27432908, (Europe PMC) | 0.49 | BioGRID, IntAct |
| RAB3IP | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| RASAL2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| RCN1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| RTKN | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| SH3BP4 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SH3PXD2A | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SIPA1L1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SKP1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| SRGAP2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SRSF12 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| STK39 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| SYDE1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| TBC1D25 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| TESK2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| TIAM1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| USP21 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| WDR6 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| XPO1 | Affinity Capture-MS | physical | 26673895, (Europe PMC) | NA | BioGRID |
| YWHAB | Affinity Capture-MS, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, coimmunoprecipitation, two hybrid | association, physical, physical association | 10713667, 12871587, 15173315, 16672277, 26496610, 27432908, 7644510, (Europe PMC) | 0.35, 0.40, 0.86 | BioGRID, IntAct, MINT |
| YWHAE | Affinity Capture-MS, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, two hybrid | physical, physical association | 10713667, 12871587, 15173315, 27432908, 27880917, 7644510, (Europe PMC) | 0.40, 0.57 | BioGRID, IntAct, MINT |
| YWHAG | Affinity Capture-MS, anti tag coimmunoprecipitation, coimmunoprecipitation | association, physical | 16672277, 26496610, 27432908, (Europe PMC) | 0.53 | BioGRID, IntAct, MINT |
| YWHAH | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, coimmunoprecipitation, two hybrid | association, physical, physical association | 10713667, 16672277, 26496610, 27432908, (Europe PMC) | 0.72 | BioGRID, IntAct, MINT |
| YWHAQ | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical | 10713667, 15629715, 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAZ | Affinity Capture-MS, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, coimmunoprecipitation, pull down, two hybrid | association, direct interaction, physical, physical association | 10713667, 12764136, 12766774, 15629715, 16672277, 26496610, 27432908, 28514442, (Europe PMC) | 0.89 | BioGRID, IntAct, MINT |
| ZBTB21 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| ZNF638 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ANKRD34A | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| CBY1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| CDC5L | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDK16 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| CDK2 | Biochemical Activity, Two-hybrid, two hybrid | physical, physical association | 16191191, 7644510, 9840943, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CENPB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CGN | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| DCLK1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| DENND4C | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| DEPDC1B | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| DOCK2 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| EDC3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| EIF4B | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EIF4E2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| FAM110A | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| FAM110B | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| FBXW11 | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, anti tag coimmunoprecipitation | association, physical, physical association | 19615732, 21807946, 22017875, 25332235, 25515538, 25900982, 26496610, 27432908, 27880917, 28514442, 29150431, (Europe PMC) | 0.35, 0.40 | BioGRID, IntAct |
| GAB2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| GIGYF1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| HDAC4 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KCTD3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KIF13B | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KIF1C | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KRT31 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| KRT35 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| KRT85 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| KSR1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| LIMA1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| LRFN1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| MAGI1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| MAPKAP1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| MAST3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| MELK | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, inference by socio-affinity scoring | physical, physical association | 12400006, 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| NADK | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| NAV1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| NF1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| PHB2 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| PHLDB2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| PLEKHA5 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| PLEKHA7 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| PPM1H | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| PSME3 | Affinity Capture-MS, two hybrid array, two hybrid prey pooling approach | physical, physical association | 27432908, (Europe PMC) | 0.49 | BioGRID, IntAct |
| RASAL2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SFN | anti tag coimmunoprecipitation, coimmunoprecipitation | association, physical association | 15173315, 16672277, (Europe PMC) | 0.40, 0.56 | IntAct, MINT |
| SH3BP4 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SH3PXD2A | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SIPA1L1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SRGAP2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SRSF12 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SYDE1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| TBC1D25 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| TESK2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| TIAM1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| USP21 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| WDR6 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAB | Affinity Capture-MS, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, coimmunoprecipitation, two hybrid | association, physical, physical association | 10713667, 12871587, 15173315, 16672277, 26496610, 27432908, 7644510, (Europe PMC) | 0.35, 0.40, 0.86 | BioGRID, IntAct, MINT |
| YWHAE | Affinity Capture-MS, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, two hybrid | physical, physical association | 10713667, 12871587, 15173315, 27432908, 27880917, 7644510, (Europe PMC) | 0.40, 0.57 | BioGRID, IntAct, MINT |
| YWHAG | Affinity Capture-MS, anti tag coimmunoprecipitation, coimmunoprecipitation | association, physical | 16672277, 26496610, 27432908, (Europe PMC) | 0.53 | BioGRID, IntAct, MINT |
| YWHAH | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, coimmunoprecipitation, two hybrid | association, physical, physical association | 10713667, 16672277, 26496610, 27432908, (Europe PMC) | 0.72 | BioGRID, IntAct, MINT |
| YWHAQ | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical | 10713667, 15629715, 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAZ | Affinity Capture-MS, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, coimmunoprecipitation, pull down, two hybrid | association, direct interaction, physical, physical association | 10713667, 12764136, 12766774, 15629715, 16672277, 26496610, 27432908, 28514442, (Europe PMC) | 0.89 | BioGRID, IntAct, MINT |
| ZBTB21 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| ZNF638 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| YWHAB | Affinity Capture-MS, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, coimmunoprecipitation, two hybrid | association, physical, physical association | 10713667, 12871587, 15173315, 16672277, 26496610, 27432908, 7644510, (Europe PMC) | 0.35, 0.40, 0.86 | BioGRID, IntAct, MINT |
| YWHAE | Affinity Capture-MS, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, two hybrid | physical, physical association | 10713667, 12871587, 15173315, 27432908, 27880917, 7644510, (Europe PMC) | 0.40, 0.57 | BioGRID, IntAct, MINT |
| YWHAG | Affinity Capture-MS, anti tag coimmunoprecipitation, coimmunoprecipitation | association, physical | 16672277, 26496610, 27432908, (Europe PMC) | 0.53 | BioGRID, IntAct, MINT |
| YWHAH | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, coimmunoprecipitation, two hybrid | association, physical, physical association | 10713667, 16672277, 26496610, 27432908, (Europe PMC) | 0.72 | BioGRID, IntAct, MINT |
| YWHAZ | Affinity Capture-MS, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, coimmunoprecipitation, pull down, two hybrid | association, direct interaction, physical, physical association | 10713667, 12764136, 12766774, 15629715, 16672277, 26496610, 27432908, 28514442, (Europe PMC) | 0.89 | BioGRID, IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AFDN | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| AGAP1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| ANKRD34A | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| AR | Reconstituted Complex | physical | 12569365, (Europe PMC) | NA | BioGRID |
| BRSK2 | Biochemical Activity | physical | 15150265, (Europe PMC) | NA | BioGRID |
| BTRC | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Proximity Label-MS, Reconstituted Complex | physical | 15845771, 21807946, 25332235, 25900982, 26091241, 26496610, 27880917, 28514442, (Europe PMC) | NA | BioGRID |
| CALU | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CAMSAP2 | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| CBY1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| CCDC28A | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CCNB1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CDC14A | Affinity Capture-Western, Biochemical Activity | physical | 20956543, (Europe PMC) | NA | BioGRID |
| CDC20 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CDC25B | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CDC5L | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDK1 | Affinity Capture-Western | physical | 11516829, (Europe PMC) | NA | BioGRID |
| CDK16 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| CDK2 | Biochemical Activity, Two-hybrid, two hybrid | physical, physical association | 16191191, 7644510, 9840943, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CDK3 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CDK5 | Affinity Capture-Western, Biochemical Activity | physical | 11516829, 22899714, (Europe PMC) | NA | BioGRID |
| CENPB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CGN | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| CHEK1 | Biochemical Activity, Reconstituted Complex | physical | 9278511, (Europe PMC) | NA | BioGRID |
| CSNK2A1 | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex | physical | 12527891, (Europe PMC) | NA | BioGRID |
| CUL1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| DCLK1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| DENND1A | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| DENND4C | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| DEPDC1B | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| DOCK2 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| EDC3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| EIF4B | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EIF4E2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| ESR1 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 11689696, (Europe PMC) | NA | BioGRID |
| FAM110A | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| FAM110B | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| FAM53C | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| FBXW11 | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, anti tag coimmunoprecipitation | association, physical, physical association | 19615732, 21807946, 22017875, 25332235, 25515538, 25900982, 26496610, 27432908, 27880917, 28514442, 29150431, (Europe PMC) | 0.35, 0.40 | BioGRID, IntAct |
| FOXM1 | Affinity Capture-Western | physical | 15024056, (Europe PMC) | NA | BioGRID |
| GAB2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| GIGYF1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| HDAC4 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KAT2B | Reconstituted Complex | physical | 11689696, (Europe PMC) | NA | BioGRID |
| KCTD3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KIF13B | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KIF1C | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KRT31 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| KRT35 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| KRT85 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| KSR1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| LIMA1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| LRFN1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| MAGI1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| MAP3K21 | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| MAPK14 | Biochemical Activity, Reconstituted Complex | physical | 11333986, (Europe PMC) | NA | BioGRID |
| MAPK1IP1L | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| MAPK9 | Biochemical Activity | physical | 15629715, (Europe PMC) | NA | BioGRID |
| MAPKAP1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| MAPKAPK2 | Biochemical Activity | physical | 15629715, (Europe PMC) | NA | BioGRID |
| MAST3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| MELK | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, inference by socio-affinity scoring | physical, physical association | 12400006, 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| NADK | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| NAV1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| NF1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| PGR | Reconstituted Complex | physical | 11689696, (Europe PMC) | NA | BioGRID |
| PHB2 | Affinity Capture-MS | physical | 17353931, (Europe PMC) | NA | BioGRID |
| PHB2 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| PHLDB2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| PLEKHA5 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| PLEKHA7 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| PPM1F | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| PPM1H | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| PRMT1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| PSME3 | Affinity Capture-MS, two hybrid array, two hybrid prey pooling approach | physical, physical association | 27432908, (Europe PMC) | 0.49 | BioGRID, IntAct |
| RAB3IP | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| RASAL2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| RCN1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| RTKN | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| SFN | anti tag coimmunoprecipitation, coimmunoprecipitation | association, physical association | 15173315, 16672277, (Europe PMC) | 0.40, 0.56 | IntAct, MINT |
| SH3BP4 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SH3PXD2A | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SIPA1L1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SKP1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| SRGAP2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SRSF12 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| STK39 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| SYDE1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| TBC1D25 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| TESK2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| TIAM1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| USP21 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| WDR6 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| XPO1 | Affinity Capture-MS | physical | 26673895, (Europe PMC) | NA | BioGRID |
| YWHAB | Affinity Capture-MS, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, coimmunoprecipitation, two hybrid | association, physical, physical association | 10713667, 12871587, 15173315, 16672277, 26496610, 27432908, 7644510, (Europe PMC) | 0.35, 0.40, 0.86 | BioGRID, IntAct, MINT |
| YWHAE | Affinity Capture-MS, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, two hybrid | physical, physical association | 10713667, 12871587, 15173315, 27432908, 27880917, 7644510, (Europe PMC) | 0.40, 0.57 | BioGRID, IntAct, MINT |
| YWHAG | Affinity Capture-MS, anti tag coimmunoprecipitation, coimmunoprecipitation | association, physical | 16672277, 26496610, 27432908, (Europe PMC) | 0.53 | BioGRID, IntAct, MINT |
| YWHAH | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, coimmunoprecipitation, two hybrid | association, physical, physical association | 10713667, 16672277, 26496610, 27432908, (Europe PMC) | 0.72 | BioGRID, IntAct, MINT |
| YWHAQ | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical | 10713667, 15629715, 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAZ | Affinity Capture-MS, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti tag coimmunoprecipitation, coimmunoprecipitation, pull down, two hybrid | association, direct interaction, physical, physical association | 10713667, 12764136, 12766774, 15629715, 16672277, 26496610, 27432908, 28514442, (Europe PMC) | 0.89 | BioGRID, IntAct, MINT |
| ZBTB21 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| ZNF638 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |