Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
BPGM
Gene Name  | BPGM (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | BPGM | |
| Protein Name | BPGM |
|
| Alternative Name(s) |
Bisphosphoglycerate mutase;BPGM;5.4.2.4;2,3-bisphosphoglycerate mutase, erythrocyte;2,3-bisphosphoglycerate synthase;5.4.2.11;2,3-diphosphoglycerate mutase;DPGM;BPG-dependent PGAM; | |
| EntrezGene ID | 669 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P07738 (protein sequence) | |
| Enzyme Class | EC 5.4.2.4 5.4.2.11 (BRENDA ) | |
| Molecular Weight | 30005 Dalton | |
| Protein Length | 259 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000172331 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: histidine phosphatase (HP) --> Family: PGAM | Historic class: Phosphoglycerate mutase | CATH ID: 3.40.50.1240 | SCOP Fold: HP | |
| Phosphatase activity | active | Catalytic signature motif: unknown | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | DisGeNet | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| N/A | |||
| Function (UniProt annotation) | |||
| Plays a major role in regulating hemoglobin oxygenaffinity by controlling the levels of its allosteric effector 2,3-bisphosphoglycerate (2,3-BPG) Also exhibits mutase (EC 54211)activity | |||
| Catalytic Activity (UniProt annotation) | |||
| 3-phospho-D-glyceroyl phosphate = 2,3-bisphospho-D-glycerate 2-phospho-D-glycerate = 3-phospho-D-glycerate | |||
| Protein Sequence | |||
| MSKYKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTAWLILEELGQEWVP VESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYNVTPPPIEESHPYYQEIYNDRRYKVCDVPLDQLPRSESLKD VLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEGISDEDIINITLPTGVPILLELDENLRAVGPHQFLGDQEA IQAAIKKVEDQGKVKQAKK |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0004082 | F:bisphosphoglycerate mutase activity |
| GO:0005829 | C:cytosol |
| GO:0005975 | P:carbohydrate metabolic process |
| GO:0006094 | P:gluconeogenesis |
| GO:0006096 | P:glycolytic process |
| GO:0007585 | P:respiratory gaseous exchange |
| GO:0016787 | F:hydrolase activity |
| GO:0043456 | P:regulation of pentose-phosphate shunt |
| GO:0046538 | F:2,3-bisphosphoglycerate-dependent phosphoglycerate mutase activity |
| GO:0048821 | P:erythrocyte development |
| GO:0061621 | P:canonical glycolysis |
| GO:0070062 | C:extracellular exosome |
