Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
ACPP
Gene Name  | ACPP (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | ACPP | |
| Protein Name | ACPP |
|
| Alternative Name(s) |
Prostatic acid phosphatase;PAP;3.1.3.2;5'-nucleotidase;5'-NT;3.1.3.5;Ecto-5'-nucleotidase;Thiamine monophosphatase;TMPase;PAPf39; | |
| EntrezGene ID | 55 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P15309 (protein sequence) | |
| Enzyme Class | EC 3.1.3.2 3.1.3.5 (BRENDA ) | |
| Molecular Weight | 44566 Dalton | |
| Protein Length | 386 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000014257 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: histidine phosphatase (HP) | Historic class: Histidine acid phosphatase | CATH ID: 3.40.50.1240 | SCOP Fold: HP | |
| Phosphatase activity | active | Catalytic signature motif: RHGD | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Isoform 1: Secreted Isoform 2: Cell membrane Lysosomemembrane Note=Appears to shuttle between the cell membraneand intracellular vesicles Colocalizes with FLOT1 at cellmembrane and in intracellular vesicles (PubMed:17638863)Colocalizes with LAMP2 on the lysosome membrane (PubMed:17897319) | |||
| Function (UniProt annotation) | |||
| A non-specific tyrosine phosphatase thatdephosphorylates a diverse number of substrates under acidicconditions (pH 4-6) including alkyl, aryl, and acyl orthophosphatemonoesters and phosphorylated proteins Has lipid phosphataseactivity and inactivates lysophosphatidic acid in seminal plasma Isoform 2: the cellular form also has ecto-5'-nucleotidase activity in dorsal root ganglion (DRG) neuronsGenerates adenosine from AMP which acts as a pain suppressor Actsas a tumor suppressor of prostate cancer through dephosphorylationof ERBB2 and deactivation of MAPK-mediated signaling | |||
| Catalytic Activity (UniProt annotation) | |||
| A phosphate monoester + H(2)O = an alcohol +phosphate A 5'-ribonucleotide + H(2)O = a ribonucleoside+ phosphate | |||
| Protein Sequence | |||
| MRAAPLLLARAASLSLGFLFLLFFWLDRSVLAKELKFVTLVFRHGDRSPIDTFPTDPIKESSWPQGFGQLTQLGMEQHYE LGEYIRKRYRKFLNESYKHEQVYIRSTDVDRTLMSAMTNLAALFPPEGVSIWNPILLWQPIPVHTVPLSEDQLLYLPFRN CPRFQELESETLKSEEFQKRLHPYKDFIATLGKLSGLHGQDLFGIWSKVYDPLYCESVHNFTLPSWATEDTMTKLRELSE LSLLSLYGIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMYSAHDTTVSGLQMALDVYNGLLPPYASCHLTELYF EKGEYFVEMYYRNETQHEPYPLMLPGCSPSCPLERFAELVGPVIPQDWSTECMTTNSHQGTEDSTD |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0003993 | F:acid phosphatase activity |
| GO:0005615 | C:extracellular space |
| GO:0005622 | C:intracellular |
| GO:0005634 | C:nucleus |
| GO:0005765 | C:lysosomal membrane |
| GO:0005886 | C:plasma membrane |
| GO:0006144 | P:purine nucleobase metabolic process |
| GO:0006772 | P:thiamine metabolic process |
| GO:0008253 | F:5'-nucleotidase activity |
| GO:0009117 | P:nucleotide metabolic process |
| GO:0012506 | C:vesicle membrane |
| GO:0016021 | C:integral component of membrane |
| GO:0016311 | P:dephosphorylation |
| GO:0016791 | F:phosphatase activity |
| GO:0030175 | C:filopodium |
| GO:0035577 | C:azurophil granule membrane |
| GO:0042131 | F:thiamine phosphate phosphatase activity |
| GO:0042802 | F:identical protein binding |
| GO:0042803 | F:protein homodimerization activity |
| GO:0043312 | P:neutrophil degranulation |
| GO:0046085 | P:adenosine metabolic process |
| GO:0051289 | P:protein homotetramerization |
| GO:0051930 | P:regulation of sensory perception of pain |
| GO:0052642 | F:lysophosphatidic acid phosphatase activity |
| GO:0060168 | P:positive regulation of adenosine receptor signaling pathway |
| GO:0070062 | C:extracellular exosome |
