DEPOD - human DEPhOsphorylation Database

Basic Information
Phosphatases
Pathway
Interacting Proteins
Phosphorylating Kinases

Gene Name	TFEB (QuickGO)	Interactive visualization of TFEB structures (A quick tutorial to explore the interctive visulaization) Representative structure: NA
Synonyms	TFEB, BHLHE35,
Protein Name	TFEB
Alternative Name(s)	Transcription factor EB;Class E basic helix-loop-helix protein 35;bHLHe35;
Protein Family	Belongs to the MiT/TFE family
EntrezGene ID	7942 (Comparitive Toxicogenomics)
UniProt AC (Human)	P19484 (protein sequence)
Enzyme Class	N/A
Molecular Weight	52865 Dalton
Protein Length	476 amino acids (AA)
Genome Browsers	NCBI \|
Crosslinking annotations	Query our ID-mapping table
Orthologues	Quest For Orthologues (QFO) \| GeneTree

Domain organization, Expression, Diseases

(show / hide)

Protein Domain	InterPro \| Pfam \| SMART	3D Structure	PDB \| DrugPort \| ModBase \| SwissModel
Polypeptide organization (Pfam)
Gene Expression	Gene Expression Atlas The Human Protein Atlas	Disease	OMIM \| ClinVar
Protein-protein interactions	STRING \| IntAct \| MINT \| BioGRID
Phosphosites	Phospho.ELM \| PhosphoSitePlus

Localization, Function, Catalytic activity and Sequence

(show / hide)

Localization (UniProt annotation)
Cytoplasm NucleusNote=Mainly present in the cytoplasm (PubMed:23434374) Underaberrant lysosomal storage conditions, it translocates from thecytoplasm to the nucleus (PubMed:23434374) In macrophages,translocates into the nucleus upon live Senterica infection(PubMed:27184844)
Function (UniProt annotation)
Transcription factor that specifically recognizes andbinds E-box sequences (5'-CANNTG-3') Efficient DNA-bindingrequires dimerization with itself or with another MiT/TFE familymember such as TFE3 or MITF In association with TFE3, activatesthe expression of CD40L in T-cells, thereby playing a role in T-cell-dependent antibody responses in activated CD4(+) T-cells andthymus-dependent humoral immunity Specifically recognizes andbinds the CLEAR-box sequence (5'-GTCACGTGAC-3') present in theregulatory region of many lysosomal genes, leading to activatetheir expression It thereby plays a central role in expression oflysosomal genes Acts as a positive regulator of autophagy bypromoting expression of genes involved in autophagy Specificallyrecognizes the gamma-E3 box, a subset of E-boxes, present in theheavy-chain immunoglobulin enhancer Plays a role in the signaltransduction processes required for normal vascularization of theplacenta
Catalytic Activity (UniProt annotation)
N/A
Protein Sequence
MASRIGLRMQLMREQAQQEEQRERMQQQAVMHYMQQQQQQQQQQLGGPPTPAINTPVHFQSPPPVPGEVLKVQSYLENPT SYHLQQSQHQKVREYLSETYGNKFAAHISPAQGSPKPPPAASPGVRAGHVLSSSAGNSAPNSPMAMLHIGSNPERELDDV IDNIMRLDDVLGYINPEMQMPNTLPLSSSHLNVYSSDPQVTASLVGVTSSSCPADLTQKRELTDAESRALAKERQKKDNH NLIERRRRFNINDRIKELGMLIPKANDLDVRWNKGTILKASVDYIRRMQKDLQKSRELENHSRRLEMTNKQLWLRIQELE MQARVHGLPTTSPSGMNMAELAQQVVKQELPSEEGPGEALMLGAEVPDPEPLPALPPQAPLPLPTQPPSPFHHLDFSHSL SFGGREDEGPPGYPEPLAPGHGSPFPSLSKKDLDLMLLDDSLLPLASDPLLSTMSPEASKASSRRSSFSMEEGDVL

Motif information from Eukaryotic Linear Motif atlas (ELM)

(show / hide)

ELM Motif	Motif Instance	Description	Motif Regex
NA	NA	NA	NA

Gene Ontology (P: Process; F: Function and C: Component terms)

(show / hide)

GO:0000981	F:RNA polymerase II transcription factor activity
GO:0001892	sequence-specific DNA binding
GO:0002250	P:embryonic placenta development
GO:0003700	P:adaptive immune response
GO:0005634	F:DNA-binding transcription factor activity
GO:0005737	C:nucleus
GO:0006351	C:cytoplasm
GO:0006355	P:transcription
GO:0006914	DNA-templated
GO:0006959	P:regulation of transcription
GO:0007040	DNA-templated
GO:0010508	P:autophagy
GO:0044212	P:humoral immune response
GO:0045944	P:lysosome organization
GO:0046983	P:positive regulation of autophagy
	F:transcription regulatory region DNA binding

TFEB is dephosphorylated by following phosphatases:

Phosphatase Gene Name	Phosphatase UniProt_AC	DephosphoSite and sequence (+/-5) in TFEB (P19484)	Bioassay Type	PubMed ID	View in Europe PMC	Reliability of the interaction
PPP3CB	P16298	Ser-142_NSAPNsPMAML;, Ser211_GVTSSsCPADL,	in vitro and in vivo	25720963,	Europe PMC
PPP3CC	P48454	Ser-142_NSAPNsPMAML;, Ser211_GVTSSsCPADL,	in vitro and in vivo	25720963,	Europe PMC
PPP3CA	Q08209	Ser-142_NSAPNsPMAML;, Ser211_GVTSSsCPADL,	in vitro and in vivo	25720963,	Europe PMC

KEGG Pathway
Reactome Pathway

Pathway ID	Pathway Name	Pathway Description (KEGG)
hsa04137	Mitophagy - animal	Mitochondria act as the energy powerhouse of the cell, and are essential for eukaryotic cells to grow and function normally. However, deleterious byproducts of oxidative phosphorylation process called reactive oxidative species (ROS) lead to mitochondrial dysfunction. If the damage is too excessive to be repaired, such mitochondria are selectively recognized and targeted for degradation by a specific mode of autophagy, termed mitophagy. The loss of the mitochondrial membrane potential can induce mitophagy, involving the kinase PINK1 and the E3 ligase Parkin. PINK1 serves as the sensor for the mitochondrial depolarization and recruits Parkin, followed by ubiquitin-dependent recruitment of mitophagy receptors. There are also several PINK1/Parkin-independent mitophagy pathways, in which a group of LIR-containing receptors are required in response to different stimuli. Mitophagy contributes to the maintenance of a healthy mitochondrial network and the prevention of programmed cell death.

Sorry, no REACTOME pathway information here!
[Feedback|Contribution]

BioGRID
IntAct
MINT
ALL

Sorry, no BioGRID interacting protein information here!
[Feedback|Contribution]

Sorry, no IntAct interacting protein information here!
[Feedback|Contribution]

Sorry, no MINT interacting protein information here!
[Feedback|Contribution]

Sorry, no interacting protein information on this protein!
[Feedback|Contribution]

Sorry, no kinases are known to phosphorylate this protein!
[Feedback|Contribution]

Top

TFEB