Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
SLC10A1
Gene Name  | SLC10A1 (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: NA |
| Synonyms | SLC10A1, NTCP, GIG29 | |
| Protein Name | SLC10A1 | |
| Alternative Name(s) | Sodium/bile acid cotransporter;Cell growth-inhibiting gene 29 protein;Na(+)/bile acid cotransporter;Na(+)/taurocholate transport protein;Sodium/taurocholate cotransporting polypeptide;Solute carrier family 10 member 1; | |
| Protein Family | Belongs to the bile acid:sodium symporter (BASS) (TC2A28) family | |
| EntrezGene ID | 6554 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q14973 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 38119 Dalton | |
| Protein Length | 349 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000100652 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - KOG2718 | eggNOG - COG0385 | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Membrane; Multi-pass membrane protein | |||
| Function (UniProt annotation) | |||
| The hepatic sodium/bile acid uptake system exhibitsbroad substrate specificity and transports various non-bile acidorganic compounds as well It is strictly dependent on theextracellular presence of sodium (Microbial infection) Acts as a receptor for hepatitis Bvirus | |||
| Catalytic Activity (UniProt annotation) | |||
| N/A | |||
| Protein Sequence | |||
| MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYGIMPLTAFVLG KVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIV ISLVLVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVL SALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLLIAIFWCYEKFKTPKDKTKMI YTAATTEETIPGALGNGTYKGEDCSPCTA | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0001618 | F:virus receptor activity |
| GO:0005886 | C:plasma membrane |
| GO:0005887 | C:integral component of plasma membrane |
| GO:0008508 | F:bile acid:sodium symporter activity |
| GO:0015721 | P:bile acid and bile salt transport |
| GO:0016323 | C:basolateral plasma membrane |
