Top
PTPRA
Localization (UniProt annotation) Membrane; Single-pass type I membraneprotein Function (UniProt annotation) N/A Catalytic Activity (UniProt annotation) Protein tyrosine phosphate + H(2)O = proteintyrosine + phosphate Protein Sequence MDSWFILVLLGSGLICVSANNATTVAPSVGITRLINSSTAEPVKEEAKTSNPTSSLTSLSVAPTFSPNITLGPTYLTTVN
SSDSDNGTTRTASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPPSGNSDSKDRRDETPIIAVMVALS
SLLVIVFIIIVLYMLRFKKYKQAGSHSNSFRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRMADDNKL
FREEFNALPACPIQATCEAASKEENKEKNRYVNILPYDHSRVHLTPVEGVPDSDYINASFINGYQEKNKFIAAQGPKEET
VNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWPDQGCWTYGNIRVSVEDVTVLVDYTVRKFCIQQVGDMTNRKPQRLI
TQFHFTSWPDFGVPFTPIGMLKFLKKVKACNPQYAGAIVVHCSAGVGRTGTFVVIDAMLDMMHTERKVDVYGFVSRIRAQ
RCQMVQTDMQYVFIYQALLEHYLYGDTELEVTSLETHLQKIYNKIPGTSNNGLEEEFKKLTSIKIQNDKMRTGNLPANMK
KNRVLQIIPYEFNRVIIPVKRGEENTDYVNASFIDGYRQKDSYIASQGPLLHTIEDFWRMIWEWKSCSIVMLTELEERGQ
EKCAQYWPSDGLVSYGDITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQ
QQSGNHPITVHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYIDAFSDYAN
FK
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
PTPRA is dephosphorylated by following phosphatases:
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-375165 NCAM signaling for neurite out-growth. The neural cell adhesion molecule, NCAM, is a member of the immunoglobulin (Ig) superfamily and is involved in a variety of cellular processes of importance for the formation and maintenance of the nervous system. The role of NCAM in neural differentiation and synaptic plasticity is presumed to depend on the modulation of intracellular signal transduction cascades. NCAM based signaling complexes can initiate downstream intracellular signals by at least two mechanisms: (1) activation of FGFR and (2) formation of intracellular signaling complexes by direct interaction with cytoplasmic interaction partners such as Fyn and FAK. Tyrosine kinases Fyn and FAK interact with NCAM and undergo phosphorylation and this transiently activates the MAPK, ERK 1 and 2, cAMP response element binding protein (CREB) and transcription factors ELK and NFkB. CREB activates transcription of genes which are important for axonal growth, survival, and synaptic plasticity in neurons.NCAM1 mediated intracellular signal transduction is represented in the figure below. The Ig domains in NCAM1 are represented in orange ovals and Fn domains in green squares. The tyrosine residues susceptible to phosphorylation are represented in red circles and their positions are numbered. Phosphorylation is represented by red arrows and dephosphorylation by yellow. Ig, Immunoglobulin domain; Fn, Fibronectin domain; Fyn, Proto-oncogene tyrosine-protein kinase Fyn; FAK, focal adhesion kinase; RPTPalpha, Receptor-type tyrosine-protein phosphatase; Grb2, Growth factor receptor-bound protein 2; SOS, Son of sevenless homolog; Raf, RAF proto-oncogene serine/threonine-protein kinase; MEK, MAPK and ERK kinase; ERK, Extracellular signal-regulated kinase; MSK1, Mitogen and stress activated protein kinase 1; CREB, Cyclic AMP-responsive element-binding protein; CRE, cAMP response elements R-HSA-5673001 RAF/MAP kinase cascade. The RAS-RAF-MEK-ERK pathway regulates processes such as proliferation, differentiation, survival, senescence and cell motility in response to growth factors, hormones and cytokines, among others. Binding of these stimuli to receptors in the plasma membrane promotes the GEF-mediated activation of RAS at the plasma membrane and initiates the three-tiered kinase cascade of the conventional MAPK cascades. GTP-bound RAS recruits RAF (the MAPK kinase kinase), and promotes its dimerization and activation (reviewed in Cseh et al, 2014; Roskoski, 2010; McKay and Morrison, 2007; Wellbrock et al, 2004). Activated RAF phosphorylates the MAPK kinase proteins MEK1 and MEK2 (also known as MAP2K1 and MAP2K2), which in turn phophorylate the proline-directed kinases ERK1 and 2 (also known as MAPK3 and MAPK1) (reviewed in Roskoski, 2012a, b; Kryiakis and Avruch, 2012). Activated ERK proteins may undergo dimerization and have identified targets in both the nucleus and the cytosol; consistent with this, a proportion of activated ERK protein relocalizes to the nucleus in response to stimuli (reviewed in Roskoski 2012b; Turjanski et al, 2007; Plotnikov et al, 2010; Cargnello et al, 2011). Although initially seen as a linear cascade originating at the plasma membrane and culminating in the nucleus, the RAS/RAF MAPK cascade is now also known to be activated from various intracellular location. Temporal and spatial specificity of the cascade is achieved in part through the interaction of pathway components with numerous scaffolding proteins (reviewed in McKay and Morrison, 2007; Brown and Sacks, 2009). The importance of the RAS/RAF MAPK cascade is highlighted by the fact that components of this pathway are mutated with high frequency in a large number of human cancers. Activating mutations in RAS are found in approximately one third of human cancers, while ~8% of tumors express an activated form of BRAF (Roberts and Der, 2007; Davies et al, 2002; Cantwell-Dorris et al, 2011)
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ASNSD1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ATXN2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID B4GAT1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID BAIAP2 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID BASP1 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID CALM1 Affinity Capture-Western physical 10893241 , (Europe PMC )NA BioGRID CANX Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID CCDC88A Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID CSE1L Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID CYB561 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID DENND4A Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID EGFR Affinity Capture-Western, Two-hybrid physical 28065597 , (Europe PMC )NA BioGRID EPB41L1 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID ERBB2 Affinity Capture-Western physical 28065597 , (Europe PMC )NA BioGRID EXOC3 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID FCN1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID FYN Affinity Capture-Western physical 9535845 , (Europe PMC )NA BioGRID GAB1 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID GABARAPL2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT GALNT12 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GPRIN3 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID GRB2 Affinity Capture-MS, Affinity Capture-Western, Proximity Label-MS, Reconstituted Complex, anti bait coimmunoprecipitation, pull down, tandem affinity purification association, direct interaction, physical, physical association 11923305 , 19380743 , 23532252 , 24189400 , 27880917 , 28330616 , 28514442 , 7518772 , 8670803 , (Europe PMC )0.84 BioGRID, IntAct, MINT HSPB1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct KCNA2 Affinity Capture-Western, Reconstituted Complex physical 9878055 , (Europe PMC )NA BioGRID KCNMA1 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID LGALS1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LGALS8 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MBP Biochemical Activity physical 23532252 , (Europe PMC )NA BioGRID NCBP1 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID NCDN Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID NF2 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID PDIA6 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID PPP4R3A Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID PSAT1 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PSD3 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID PTPRA Affinity Capture-MS, comigration in sds page, tox-r dimerization assay association, direct interaction, physical 15978577 , 27432908 , (Europe PMC )0.51 BioGRID, IntAct, MINT PTPRE Affinity Capture-MS, Proximity Label-MS, pull down association, physical 27432908 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct PTPRG Affinity Capture-Western physical 23532252 , (Europe PMC )NA BioGRID RAPH1 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID SAAL1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID SP4 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SRC Affinity Capture-Western, anti bait coimmunoprecipitation, coimmunoprecipitation, pull down association, direct interaction, physical, physical association 10698938 , 11923305 , 23532252 , (Europe PMC )0.66 BioGRID, IntAct, MINT TMEM51 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID TNPO1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID TNPO3 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID TPCN2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TXNDC5 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID UVRAG Affinity Capture-MS, anti tag coimmunoprecipitation association, physical, physical association 20562859 , (Europe PMC )0.50 BioGRID, IntAct VPS25 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID XPO4 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID XPO5 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID XPO6 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID XPOT Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID YWHAZ Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source GDNF pull down association 28330616 , (Europe PMC )0.35 IntAct GRB2 Affinity Capture-MS, Affinity Capture-Western, Proximity Label-MS, Reconstituted Complex, anti bait coimmunoprecipitation, pull down, tandem affinity purification association, direct interaction, physical, physical association 11923305 , 19380743 , 23532252 , 24189400 , 27880917 , 28330616 , 28514442 , 7518772 , 8670803 , (Europe PMC )0.84 BioGRID, IntAct, MINT HSPB1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PPP4R3A anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct PTPRA Affinity Capture-MS, comigration in sds page, tox-r dimerization assay association, direct interaction, physical 15978577 , 27432908 , (Europe PMC )0.51 BioGRID, IntAct, MINT PTPRE Affinity Capture-MS, Proximity Label-MS, pull down association, physical 27432908 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct SRC Affinity Capture-Western, anti bait coimmunoprecipitation, coimmunoprecipitation, pull down association, direct interaction, physical, physical association 10698938 , 11923305 , 23532252 , (Europe PMC )0.66 BioGRID, IntAct, MINT UVRAG Affinity Capture-MS, anti tag coimmunoprecipitation association, physical, physical association 20562859 , (Europe PMC )0.50 BioGRID, IntAct YWHAZ Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source GRB2 Affinity Capture-MS, Affinity Capture-Western, Proximity Label-MS, Reconstituted Complex, anti bait coimmunoprecipitation, pull down, tandem affinity purification association, direct interaction, physical, physical association 11923305 , 19380743 , 23532252 , 24189400 , 27880917 , 28330616 , 28514442 , 7518772 , 8670803 , (Europe PMC )0.84 BioGRID, IntAct, MINT PTPRA Affinity Capture-MS, comigration in sds page, tox-r dimerization assay association, direct interaction, physical 15978577 , 27432908 , (Europe PMC )0.51 BioGRID, IntAct, MINT SRC Affinity Capture-Western, anti bait coimmunoprecipitation, coimmunoprecipitation, pull down association, direct interaction, physical, physical association 10698938 , 11923305 , 23532252 , (Europe PMC )0.66 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ASNSD1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ATXN2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID B4GAT1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID BAIAP2 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID BASP1 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID CALM1 Affinity Capture-Western physical 10893241 , (Europe PMC )NA BioGRID CANX Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID CCDC88A Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID CSE1L Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID CYB561 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID DENND4A Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID EGFR Affinity Capture-Western, Two-hybrid physical 28065597 , (Europe PMC )NA BioGRID EPB41L1 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID ERBB2 Affinity Capture-Western physical 28065597 , (Europe PMC )NA BioGRID EXOC3 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID FCN1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID FYN Affinity Capture-Western physical 9535845 , (Europe PMC )NA BioGRID GAB1 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID GABARAPL2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT GALNT12 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GDNF pull down association 28330616 , (Europe PMC )0.35 IntAct GPRIN3 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID GRB2 Affinity Capture-MS, Affinity Capture-Western, Proximity Label-MS, Reconstituted Complex, anti bait coimmunoprecipitation, pull down, tandem affinity purification association, direct interaction, physical, physical association 11923305 , 19380743 , 23532252 , 24189400 , 27880917 , 28330616 , 28514442 , 7518772 , 8670803 , (Europe PMC )0.84 BioGRID, IntAct, MINT HSPB1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct KCNA2 Affinity Capture-Western, Reconstituted Complex physical 9878055 , (Europe PMC )NA BioGRID KCNMA1 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID LGALS1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LGALS8 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MBP Biochemical Activity physical 23532252 , (Europe PMC )NA BioGRID NCBP1 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID NCDN Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID NF2 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID PDIA6 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID PPP4R3A Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID PPP4R3A anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct PSAT1 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PSD3 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID PTPRA Affinity Capture-MS, comigration in sds page, tox-r dimerization assay association, direct interaction, physical 15978577 , 27432908 , (Europe PMC )0.51 BioGRID, IntAct, MINT PTPRE Affinity Capture-MS, Proximity Label-MS, pull down association, physical 27432908 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct PTPRG Affinity Capture-Western physical 23532252 , (Europe PMC )NA BioGRID RAPH1 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID SAAL1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID SP4 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SRC Affinity Capture-Western, anti bait coimmunoprecipitation, coimmunoprecipitation, pull down association, direct interaction, physical, physical association 10698938 , 11923305 , 23532252 , (Europe PMC )0.66 BioGRID, IntAct, MINT TMEM51 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID TNPO1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID TNPO3 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID TPCN2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TXNDC5 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID UVRAG Affinity Capture-MS, anti tag coimmunoprecipitation association, physical, physical association 20562859 , (Europe PMC )0.50 BioGRID, IntAct VPS25 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID XPO4 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID XPO5 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID XPO6 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID XPOT Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID YWHAZ Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
PRKCD S180_QAGSHSNsFRLSNGR , S180_YMLRFKKsKQAGSHS , S189_QAGSHSNsFRLSNGR , S204_PLLARSPsTNRKYPP , S204_TEDVEPQsVPLLARS , S213_PLLARSPsTNRKYPP , in vitro, in vivo 11676480 , 11923305 , 19651622 ,(Europe PMC )HPRD, PhosphoSitePlus , SRC Y789_EFCYKVVyEYIDAFS , Y789_YIDAFSDyANFK , Y798_YIDAFSDyANFK , in vitro, in vivo 11923305 , 16497976 , 17016520 , 17389395 , 18578522 , 20068231 , 7518772 ,(Europe PMC )HPRD, PhosphoSitePlus , Unknown S178_VLYMLRFsKYKQAGS , S187_SKQAGSHsNSFRLSN , S187_YKQAGSHsNSFRLSN , S189_QAGSHSNsFRLSNGR , S213_PLLARSPsTNRKYPP , Y262_ATCEAASyEENKEKN , Y271_ENKEKNRyVNILPYD , Y588_RGEENTDyVNASFID , Y782_VQTLEQYyFCYKVVQ , Y791_CYKVVQEyIDAFSDY , Y798_YIDAFSDyANFK , HTP, LTP, in vivo 11676480 , 11923305 , 16497976 , 17016520 , 17081983 , 17507376 , 18083107 , 18578522 , 7518772 ,(Europe PMC )HPRD, PhosphoELM ,