Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
NFU1
Gene Name  | NFU1 (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: 2M5O |
| Synonyms | NFU1, HIRIP5 | |
| Protein Name | NFU1 | |
| Alternative Name(s) | NFU1 iron-sulfur cluster scaffold homolog, mitochondrial;HIRA-interacting protein 5; | |
| Protein Family | Belongs to the NifU family | |
| EntrezGene ID | 27247 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q9UMS0 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 28463 Dalton | |
| Protein Length | 254 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000169599 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - KOG2358 | eggNOG - COG0694 | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Mitochondrion Cytoplasm, cytosol | |||
| Function (UniProt annotation) | |||
| Iron-sulfur cluster scaffold protein which can assemble[4Fe-4S] clusters and deliver them to target proteins | |||
| Catalytic Activity (UniProt annotation) | |||
| N/A | |||
| Protein Sequence | |||
| MAATARRGWGAAAVAAGLRRRFCHMLKNPYTIKKQPLHQFVQRPLFPLPAAFYHPVRYMFIQTQDTPNPNSLKFIPGKPV LETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDFITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGE AGSEEDDEVVAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQ VMDDESDEKEANSP | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0005506 | F:iron ion binding |
| GO:0005634 | C:nucleus |
| GO:0005654 | C:nucleoplasm |
| GO:0005739 | C:mitochondrion |
| GO:0005829 | C:cytosol |
| GO:0016226 | P:iron-sulfur cluster assembly |
| GO:0051539 | F:4 iron |
