Top
MAPK6
Localization (UniProt annotation) Cytoplasm Nucleus Note=Translocates to the cytoplasm followinginteraction with MAPKAPK5 Function (UniProt annotation) Atypical MAPK protein Phosphorylates microtubule-associated protein 2 (MAP2) and MAPKAPK5 The precise role of thecomplex formed with MAPKAPK5 is still unclear, but the complexfollows a complex set of phosphorylation events: upon interactionwith atypical MAPKAPK5, ERK3/MAPK6 is phosphorylated at Ser-189and then mediates phosphorylation and activation of MAPKAPK5,which in turn phosphorylates ERK3/MAPK6 May promote entry in thecell cycle (By similarity) Catalytic Activity (UniProt annotation) ATP + a protein = ADP + a phosphoprotein Protein Sequence MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAIKKIVLTDPQSVKHALREIKIIRRLDHDNIVKV
FEILGPSGSQLTDDVGSLTELNSVYIVQEYMETDLANVLEQGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFI
NTEDLVLKIGDFGLARIMDPHYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQELLSVIPVYIRNDMTEPHKPLTQLLPGISREALDFLEQILTFSPMDRLTAEEALSHPYMSIYS
FPMDEPISSHPFHIEDEVDDILLMDETHSHIYNWERYHDCQFSEHDWPVHNNFDIDEVQLDPRALSDVTDEEEVQVDPRK
YLDGDREKYLEDPAFDTNYSTEPCWQYSDHHENKYCDLECSHTCNYKTRSSSYLDNLVWRESEVNHYYEPKLIIDLSNWK
EQSKEKSDKKGKSKCERNGLVKAQIALEEASQQLAGKEREKNQGFDFDSFIAGTIQLSSQHEPTDVVDKLNDLNSSVSQL
ELKSLISKSVSQEKQEKGMANLAQLEALYQSSWDSQFVSGGEDCFFINQFCEVRKDEQVEKENTYTSYLDKFFSRKEDTE
MLETEPVEDGKLGERGHEEGFLNNSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHQTYSSILKHL
N
ELM Motif Motif Instance
Description Motif Regex NA NA NA NA
MAPK6 is dephosphorylated by following phosphatases:
Pathway ID Pathway Name Pathway Description (KEGG) hsa04657 IL-17 signaling pathway The interleukin 17 (IL-17) family, a subset of cytokines consisting of IL-17A-F, plays crucial roles in both acute and chronic inflammatory responses. IL-17A, the hallmark cytokine of the newly defined T helper 17 (TH17) cell subset, has important roles in protecting the host against extracellular pathogens, but also promotes inflammatory pathology in autoimmune disease, whereas IL-17F is mainly involved in mucosal host defense mechanisms. IL-17E (IL-25) is an amplifier of Th2 immune responses. IL-17C has biological functions similar to those of IL-17A. The functions of IL-17B and IL-17D remain largely elusive. The IL-17 family signals via their correspondent receptors and activates downstream pathways that include NF-kappaB, MAPKs and C/EBPs to induce the expression of antimicrobial peptides, cytokines and chemokines. The receptor proximal adaptor Act1 (an NF-kappaB activator 1) is considered as the master mediator in IL-17A signaling. It is likely that Act1 is a common signal adaptor also shared by other members mediated signalings in this family.
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-5687128 MAPK6/MAPK4 signaling. MAPK6 and MAPK4 (also known as ERK3 and ERK4) are vertebrate-specific atypical MAP kinases. Atypical MAPK are less well characterized than their conventional counterparts, and are generally classified as such based on their lack of activation by MAPKK family members. Unlike the conventional MAPK proteins, which contain a Thr-X-Tyr motif in the activation loop, MAPK6 and 4 have a single Ser-Glu-Gly phospho-acceptor motif (reviewed in Coulombe and Meloche, 2007; Cargnello et al, 2011). MAPK6 is also distinct in being an unstable kinase, whose turnover is mediated by ubiquitin-dependent degradation (Coulombe et al, 2003; Coulombe et al, 2004). The biological functions and pathways governing MAPK6 and 4 are not well established. MAPK6 and 4 are phosphorylated downstream of class I p21 activated kinases (PAKs) in a RAC- or CDC42-dependent manner (Deleris et al, 2008; Perander et al, 2008; Deleris et al, 2011; De La Mota-Peynado et al, 2011). One of the only well established substrates of MAPK6 and 4 is MAPKAPK5, which contributes to cell motility by promoting the HSBP1-dependent rearrangement of F-actin (Gerits et al, 2007; Kostenko et al, 2009a; reviewed in Kostenko et al, 2011b). The atypical MAPKs also contribute to cell motility and invasiveness through the NCOA3:ETV4-dependent regulation of MMP gene expression (Long et al, 2012; Yan et al, 2008; Qin et al, 2008)
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ACTG1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ACTR1B Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT AHSG Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ALB Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID AMPH Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ANAPC5 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ANK3 Two-hybrid physical 20936779 , (Europe PMC )NA BioGRID APBA2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT APOA1 Affinity Capture-MS, Two-hybrid, two hybrid physical, physical association 21900206 , 28514442 , (Europe PMC )0.37 BioGRID, IntAct, MINT ARHGDIA Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ARPC3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ATG9A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ATP5PF Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID AURKA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 23443559 , 26972000 , 29426014 , (Europe PMC )0.53 BioGRID, IntAct BAG6 Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID BARX1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT BBS10 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT C3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CA1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CA12 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CALR Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CASP6 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CCND3 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct CCT3 Two-hybrid, anti tag coimmunoprecipitation, two hybrid pooling approach association, physical, physical association 20936779 , 26972000 , (Europe PMC )0.55 BioGRID, IntAct CDH13 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CERS1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CFAP298 Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID CFL1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CNTN1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CNTRL Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct COPS6 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CSE1L Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct CYTH2 Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID DBN1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DCTN2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DDOST Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DDR1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DGKZ Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DKC1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DNAJC28 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DPPA4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DST Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct EDF1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT EEF1A2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT EGLN3 Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, two hybrid array association, physical, physical association 21988832 , 26972000 , (Europe PMC )0.68 BioGRID, IntAct EIF1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT EIF2S3 Affinity Capture-MS, tandem affinity purification association, physical 23602568 , (Europe PMC )0.35 BioGRID, IntAct EIF3C Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID EIF4A1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ELAVL1 Affinity Capture-RNA physical 19322201 , (Europe PMC )NA BioGRID ELOF1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT EMD Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT FAM49B Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT FBXL16 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT FGA Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FGB Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FGG Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FOXO3 Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID FXYD3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT GALNT7 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct GATA1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT GLRX3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT GORASP1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT GPX1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HACL1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HAUS2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HBA2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HBB Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HDAC11 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HERC2 Affinity Capture-MS physical 23602568 , 28514442 , (Europe PMC )NA BioGRID HIP1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HNRNPA0 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HNRNPD Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HNRNPH3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HNRNPL Affinity Capture-RNA physical 28611215 , (Europe PMC )NA BioGRID HP Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HSP90AB1 Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct HSP90B1 Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct HSPD1 Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct IDH3B Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT IGHG2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID INS Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ITGB3BP Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ITSN1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT JUNB Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct KDSR Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct KLC1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT KNSTRN Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID LPXN Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MAP3K12 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MAP3K7 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MAPK6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 23602568 , 26972000 , (Europe PMC )0.35 BioGRID, IntAct MAPKAPK5 Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, tandem affinity purification, two hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid association, physical, physical association 20936779 , 21900206 , 23602568 , 25416956 , 26972000 , 28514442 , 29426014 , (Europe PMC )0.62, 0.85 BioGRID, IntAct, MINT MASP1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MBIP Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct MBOAT7 Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID MCM3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MDK Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT METTL17 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT METTL2A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MGAT1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MIPEP Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MOK Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MON1A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MTG2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MYBL2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MYOZ3 Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID MZB1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NAT9 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NAXE Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID NDUFS6 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NECTIN2 Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID NELFB Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NEURL4 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 22261722 , 23602568 , 26972000 , 28514442 , 29426014 , (Europe PMC )0.35, 0.53 BioGRID, IntAct NOL4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NRXN2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NUDT5 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ORM1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID OSTF1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PDCD6IP Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PDLIM1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PHACTR3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PHC2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PHGDH Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PIH1D1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PLEKHM1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PLK1 Two-hybrid, anti tag coimmunoprecipitation, two hybrid association, physical, physical association 21900206 , 29426014 , (Europe PMC )0.55 BioGRID, IntAct, MINT PLSCR1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PPBP Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PPP1R7 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PPP2R1A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PRKAB1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PRKAR1A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PRPF38A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PSAT1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PSIP1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PSMA7 Affinity Capture-MS, tandem affinity purification association, physical 23602568 , (Europe PMC )0.35 BioGRID, IntAct PTPMT1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RAB2A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RAB31 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RACK1 Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID RANBP9 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RAP1GAP Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RARA Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RBL1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RGS19 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RPL10 Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID RRP7A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SEPT3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SEPT5 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SERPINA1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SERPINA4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SERPINB4 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SHC1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SLC20A1 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct SLC41A3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SMAD6 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SMS Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SNAPC4 Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID SNW1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SOCS3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SPG7 Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID SPRR2D Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SPTAN1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SRSF5 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT STK40 Affinity Capture-MS physical 28089446 , (Europe PMC )NA BioGRID STX7 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TDP2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TF Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID THAP4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TPI1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TRIM25 Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID TTK Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TUBA1A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT UBA52 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT UBE2L3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT UBE3A Affinity Capture-Western, Co-fractionation physical 22645313 , (Europe PMC )NA BioGRID URB1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT USP20 Affinity Capture-Western, Biochemical Activity physical 28167606 , (Europe PMC )NA BioGRID VPS26C Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID WDR26 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT WDR34 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT WFS1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT WWC1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF133 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF205 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF28 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZNF331 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF579 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF600 Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct ZNF671 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF7 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZNF775 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF813 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZNF92 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AAAS anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ABCD3 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ACSL3 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ACTG1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ACTR1B Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ADRM1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct AIMP2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct AMPH Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ANAPC5 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ANK3 two hybrid pooling approach physical association 20936779 , (Europe PMC )0.37 IntAct ANKHD1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct AP2S1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct AP3D1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct APBA2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT APOA1 Affinity Capture-MS, Two-hybrid, two hybrid physical, physical association 21900206 , 28514442 , (Europe PMC )0.37 BioGRID, IntAct, MINT ARFGAP3 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ARHGDIA Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ARMCX5 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ARPC3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ASNA1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ASPM anti tag coimmunoprecipitation association 26972000 , 29426014 , (Europe PMC )0.53 IntAct ATAD3A anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ATG9A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ATP1A1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ATP1B3 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ATP5F1A anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ATP5F1B anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ATP5F1C anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ATP5H anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ATP5J two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT ATP6AP1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ATP6AP2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ATP6V1H anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct AURKA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 23443559 , 26972000 , 29426014 , (Europe PMC )0.53 BioGRID, IntAct AURKB anti tag coimmunoprecipitation association 26972000 , 29426014 , (Europe PMC )0.53 IntAct BAG2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct BAG6 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct BARX1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT BBS10 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT BCAP31 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct BCKDK anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct BOLA2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct BRCA2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct C21orf59 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT CA1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CA12 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CAD anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CALML5 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CALR Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CASP6 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CCND3 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct CCNT1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CCNT2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CCT2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CCT3 Two-hybrid, anti tag coimmunoprecipitation, two hybrid pooling approach association, physical, physical association 20936779 , 26972000 , (Europe PMC )0.55 BioGRID, IntAct CCT4 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CCT6A anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CCT7 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CCT8 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CDC42 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CDC6 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CDC7 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CDH13 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CDIPT anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CDKN2A anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CDO1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CEP170 anti tag coimmunoprecipitation association 26972000 , 29426014 , (Europe PMC )0.35 IntAct CEPT1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CERS1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CFL1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CLPX anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CNTN1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CNTRL Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct COPS6 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CRELD2 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT CSE1L Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct CTNNB1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CYTH2 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT DBN1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DCTN2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DDOST Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DDR1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DGKZ Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DHX34 anti tag coimmunoprecipitation association 26972000 , 29426014 , (Europe PMC )0.53 IntAct DKC1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DNAJA1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct DNAJA2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct DNAJA3 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct DNAJB12 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct DNAJB6 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct DNAJC28 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DNAJC7 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct DPPA4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DSC3 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct DSCR3 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT DST Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct DTYMK anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct DYNLL1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ECD anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ECH1 anti tag coimmunoprecipitation association 26972000 , 29426014 , (Europe PMC )0.53 IntAct ECI2 anti tag coimmunoprecipitation association 26972000 , 29426014 , (Europe PMC )0.35 IntAct ECPAS anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct EDF1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT EEF1A2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT EEF1D display technology physical association 20195357 , (Europe PMC )0.40 IntAct EGLN3 Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, two hybrid array association, physical, physical association 21988832 , 26972000 , (Europe PMC )0.68 BioGRID, IntAct EIF1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT EIF2S3 Affinity Capture-MS, tandem affinity purification association, physical 23602568 , (Europe PMC )0.35 BioGRID, IntAct EIF3C anti tag coimmunoprecipitation, two hybrid association, physical association 21900206 , 29426014 , (Europe PMC )0.55 IntAct, MINT EIF4A1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ELOF1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ELP1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct EMD Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT FAF2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct FAM49B Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT FANCI anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct FAR1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct FARSA anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct FASTKD5 anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct FBXL16 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT FDFT1 anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct FOXO3 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT FUNDC2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct FXYD3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT GALNT7 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct GATA1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT GET4 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct GLRX3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT GLUL anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct GORASP1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT GPN1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct GPX1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HACL1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HAUS2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HAX1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct HDAC11 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HERC2 anti tag coimmunoprecipitation, tandem affinity purification association 23602568 , 26972000 , 29426014 , (Europe PMC )0.64 IntAct HIP1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HMGN2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct HNRNPA0 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HNRNPD Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HNRNPH3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HSDL2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct HSP90AB1 Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct HSP90B1 Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct HSPA1A anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct HSPA4 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct HSPA4L anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct HSPA8 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct HSPB1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct HSPD1 Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct HSPH1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct HUWE1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct IDH3B Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ILF2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct INS Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT IPO7 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct IPO9 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct IRAK1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct IRS4 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ITGB3BP Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ITSN1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT JUNB Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct KDSR Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct KLC1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT KNSTRN two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT KRT16 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct LETM1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct LONP1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct LONP2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct LPXN Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT LSM5 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct MACO1 anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct MAGED1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct MAGED2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct MAP3K12 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MAP3K7 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MAP7D1 anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct MAPK6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 23602568 , 26972000 , (Europe PMC )0.35 BioGRID, IntAct MAPKAPK5 Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, tandem affinity purification, two hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid association, physical, physical association 20936779 , 21900206 , 23602568 , 25416956 , 26972000 , 28514442 , 29426014 , (Europe PMC )0.62, 0.85 BioGRID, IntAct, MINT MARCH7 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct MASP1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MBIP Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct MBOAT7 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT MCM3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MCM4 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct MCM7 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct MDK Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT METTL13 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct METTL17 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT METTL2A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MGAT1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MIPEP Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MIS18A anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct MLF2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct MOK Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MON1A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MRPL17 anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct MTG2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MYBL2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MYCBP2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct MYO1B anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct MYO9A anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct MYOZ3 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT MZB1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NAT9 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NAXE two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT NCOA4 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct NDUFA4 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct NDUFAF4 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct NDUFB10 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct NDUFS3 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct NDUFS6 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NECTIN2 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT NELFB Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NEURL4 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 22261722 , 23602568 , 26972000 , 28514442 , 29426014 , (Europe PMC )0.35, 0.53 BioGRID, IntAct NOL4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NRXN2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NTPCR anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct NUDT5 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT OSTF1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PDCD6IP Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PDLIM1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PFDN6 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PHACTR3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PHC2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PHGDH Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PIH1D1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PIK3R2 anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct PLEKHM1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PLK1 Two-hybrid, anti tag coimmunoprecipitation, two hybrid association, physical, physical association 21900206 , 29426014 , (Europe PMC )0.55 BioGRID, IntAct, MINT PLSCR1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT POLD1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct POLR1A anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct POLR1C anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct POLR2A anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct POLR2B anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct POLR2C anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct POLR2H anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PPBP Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PPFIA1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PPP1R7 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PPP2R1A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PPT1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PRKAB1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PRKAR1A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PRKAR2A anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PRPF38A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PSAT1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PSIP1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PSMA7 Affinity Capture-MS, tandem affinity purification association, physical 23602568 , (Europe PMC )0.35 BioGRID, IntAct PSMB4 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMC1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMC2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMC3 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMC4 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMC5 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMC6 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMD1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMD11 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMD12 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMD13 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMD14 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMD2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMD3 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMD4 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMD6 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMD7 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSME2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSME3 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PTOV1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PTPMT1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RAB2A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RAB31 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RACK1 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT RAD23B anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct RAD50 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct RADX anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct RAF1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct RANBP9 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RAP1GAP Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RARA Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RBL1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RGS19 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RIF1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct RNF126 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct RPL10 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT RPS27 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct RPS27A anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct RPS27L anti tag coimmunoprecipitation association 26972000 , 29426014 , (Europe PMC )0.53 IntAct RRP7A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RSL1D1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SEPT3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SEPT5 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SERPINA4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SFXN1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SGTA anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SHC1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SLC16A1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SLC1A5 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SLC20A1 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct SLC25A11 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SLC25A13 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SLC25A3 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SLC25A5 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SLC27A4 anti tag coimmunoprecipitation association 26972000 , 29426014 , (Europe PMC )0.53 IntAct SLC41A3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SLC7A1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SMAD6 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SMS Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SNAPC4 {ECO:0000312|EMBL:CAI13935.1, two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT SNW1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SOCS3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SPART anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SPG7 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT SPRR2D Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SPTAN1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SPTLC1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SQSTM1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SRSF5 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SSBP1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SSSCA1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ST7 anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct STUB1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct STX7 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SUGT1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SUMO2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SUSD4 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT SYAP1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct TCAF1 anti tag coimmunoprecipitation association 26972000 , 29426014 , (Europe PMC )0.53 IntAct TCEAL1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct TCP1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct TDP2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TELO2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct THAP4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TM9SF2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct TMBIM6 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct TMCO1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct TMEM165 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct TMPO anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct TOMM20 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct TOR1AIP1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct TPD52 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct TPI1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TRIM33 anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct TRMT2A anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct TTK Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TUBA1A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TUBA1C anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct UBA52 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT UBE2L3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT UBE3A anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct UBL4A anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct UBR5 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct UCHL5 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct URB1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT USP9X anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct VAT1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct VDAC1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct VDAC2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct VIM anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct VPS18 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct WAPL anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct WDR26 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT WDR34 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT WDR6 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct WFS1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT WWC1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT YTHDF3 anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct ZNF133 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF205 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF281 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ZNF331 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF579 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF600 Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct ZNF671 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF775 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ACTR1B Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT AMPH Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ANAPC5 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT APBA2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT APOA1 Affinity Capture-MS, Two-hybrid, two hybrid physical, physical association 21900206 , 28514442 , (Europe PMC )0.37 BioGRID, IntAct, MINT ARHGDIA Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ARPC3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ATG9A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ATP5J two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT BARX1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT BBS10 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT C21orf59 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT CA1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CA12 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CALR Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CASP6 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CDH13 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CERS1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CFL1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CNTN1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT COPS6 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CRELD2 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT CYTH2 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT DBN1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DCTN2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DDOST Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DDR1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DGKZ Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DKC1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DNAJC28 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DPPA4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DSCR3 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT EDF1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT EEF1A2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT EIF1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT EIF3C anti tag coimmunoprecipitation, two hybrid association, physical association 21900206 , 29426014 , (Europe PMC )0.55 IntAct, MINT EIF4A1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ELOF1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT EMD Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT FAM49B Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT FBXL16 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT FOXO3 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT FXYD3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT GATA1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT GLRX3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT GORASP1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT GPX1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HACL1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HAUS2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HDAC11 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HIP1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HNRNPA0 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HNRNPD Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HNRNPH3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT IDH3B Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT INS Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ITGB3BP Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ITSN1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT KLC1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT KNSTRN two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT LPXN Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MAP3K12 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MAP3K7 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MAPKAPK5 Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, tandem affinity purification, two hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid association, physical, physical association 20936779 , 21900206 , 23602568 , 25416956 , 26972000 , 28514442 , 29426014 , (Europe PMC )0.62, 0.85 BioGRID, IntAct, MINT MASP1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MBOAT7 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT MCM3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MDK Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT METTL17 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT METTL2A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MGAT1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MIPEP Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MOK Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MON1A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MTG2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MYBL2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MYOZ3 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT MZB1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NAT9 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NAXE two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT NDUFS6 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NECTIN2 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT NELFB Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NOL4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NRXN2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NUDT5 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT OSTF1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PDCD6IP Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PDLIM1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PHACTR3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PHC2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PHGDH Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PIH1D1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PLEKHM1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PLK1 Two-hybrid, anti tag coimmunoprecipitation, two hybrid association, physical, physical association 21900206 , 29426014 , (Europe PMC )0.55 BioGRID, IntAct, MINT PLSCR1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PPBP Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PPP1R7 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PPP2R1A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PRKAB1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PRKAR1A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PRPF38A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PSAT1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PSIP1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PTPMT1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RAB2A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RAB31 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RACK1 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT RANBP9 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RAP1GAP Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RARA Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RBL1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RGS19 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RPL10 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT RRP7A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SEPT3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SEPT5 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SERPINA4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SHC1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SLC41A3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SMAD6 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SMS Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SNAPC4 {ECO:0000312|EMBL:CAI13935.1, two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT SNW1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SOCS3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SPG7 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT SPRR2D Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SPTAN1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SRSF5 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT STX7 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SUSD4 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT TDP2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT THAP4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TPI1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TTK Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TUBA1A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT UBA52 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT UBE2L3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT URB1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT WDR26 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT WDR34 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT WFS1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT WWC1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF133 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF205 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF331 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF579 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF671 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF775 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AAAS anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ABCD3 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ACSL3 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ACTG1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ACTR1B Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ADRM1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct AHSG Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID AIMP2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ALB Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID AMPH Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ANAPC5 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ANK3 Two-hybrid physical 20936779 , (Europe PMC )NA BioGRID ANK3 two hybrid pooling approach physical association 20936779 , (Europe PMC )0.37 IntAct ANKHD1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct AP2S1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct AP3D1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct APBA2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT APOA1 Affinity Capture-MS, Two-hybrid, two hybrid physical, physical association 21900206 , 28514442 , (Europe PMC )0.37 BioGRID, IntAct, MINT ARFGAP3 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ARHGDIA Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ARMCX5 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ARPC3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ASNA1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ASPM anti tag coimmunoprecipitation association 26972000 , 29426014 , (Europe PMC )0.53 IntAct ATAD3A anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ATG9A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ATP1A1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ATP1B3 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ATP5F1A anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ATP5F1B anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ATP5F1C anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ATP5H anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ATP5J two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT ATP5PF Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID ATP6AP1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ATP6AP2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ATP6V1H anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct AURKA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 23443559 , 26972000 , 29426014 , (Europe PMC )0.53 BioGRID, IntAct AURKB anti tag coimmunoprecipitation association 26972000 , 29426014 , (Europe PMC )0.53 IntAct BAG2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct BAG6 Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID BAG6 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct BARX1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT BBS10 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT BCAP31 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct BCKDK anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct BOLA2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct BRCA2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct C21orf59 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT C3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CA1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CA12 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CAD anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CALML5 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CALR Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CASP6 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CCND3 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct CCNT1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CCNT2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CCT2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CCT3 Two-hybrid, anti tag coimmunoprecipitation, two hybrid pooling approach association, physical, physical association 20936779 , 26972000 , (Europe PMC )0.55 BioGRID, IntAct CCT4 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CCT6A anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CCT7 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CCT8 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CDC42 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CDC6 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CDC7 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CDH13 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CDIPT anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CDKN2A anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CDO1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CEP170 anti tag coimmunoprecipitation association 26972000 , 29426014 , (Europe PMC )0.35 IntAct CEPT1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CERS1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CFAP298 Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID CFL1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CLPX anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CNTN1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CNTRL Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct COPS6 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CRELD2 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT CSE1L Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct CTNNB1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct CYTH2 Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID CYTH2 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT DBN1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DCTN2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DDOST Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DDR1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DGKZ Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DHX34 anti tag coimmunoprecipitation association 26972000 , 29426014 , (Europe PMC )0.53 IntAct DKC1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DNAJA1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct DNAJA2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct DNAJA3 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct DNAJB12 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct DNAJB6 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct DNAJC28 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DNAJC7 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct DPPA4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DSC3 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct DSCR3 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT DST Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct DTYMK anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct DYNLL1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ECD anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ECH1 anti tag coimmunoprecipitation association 26972000 , 29426014 , (Europe PMC )0.53 IntAct ECI2 anti tag coimmunoprecipitation association 26972000 , 29426014 , (Europe PMC )0.35 IntAct ECPAS anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct EDF1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT EEF1A2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT EEF1D display technology physical association 20195357 , (Europe PMC )0.40 IntAct EGLN3 Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, two hybrid array association, physical, physical association 21988832 , 26972000 , (Europe PMC )0.68 BioGRID, IntAct EIF1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT EIF2S3 Affinity Capture-MS, tandem affinity purification association, physical 23602568 , (Europe PMC )0.35 BioGRID, IntAct EIF3C Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID EIF3C anti tag coimmunoprecipitation, two hybrid association, physical association 21900206 , 29426014 , (Europe PMC )0.55 IntAct, MINT EIF4A1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ELAVL1 Affinity Capture-RNA physical 19322201 , (Europe PMC )NA BioGRID ELOF1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ELP1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct EMD Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT FAF2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct FAM49B Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT FANCI anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct FAR1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct FARSA anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct FASTKD5 anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct FBXL16 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT FDFT1 anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct FGA Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FGB Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FGG Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FOXO3 Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID FOXO3 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT FUNDC2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct FXYD3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT GALNT7 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct GATA1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT GET4 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct GLRX3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT GLUL anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct GORASP1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT GPN1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct GPX1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HACL1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HAUS2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HAX1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct HBA2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HBB Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HDAC11 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HERC2 Affinity Capture-MS physical 23602568 , 28514442 , (Europe PMC )NA BioGRID HERC2 anti tag coimmunoprecipitation, tandem affinity purification association 23602568 , 26972000 , 29426014 , (Europe PMC )0.64 IntAct HIP1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HMGN2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct HNRNPA0 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HNRNPD Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HNRNPH3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HNRNPL Affinity Capture-RNA physical 28611215 , (Europe PMC )NA BioGRID HP Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HSDL2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct HSP90AB1 Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct HSP90B1 Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct HSPA1A anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct HSPA4 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct HSPA4L anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct HSPA8 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct HSPB1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct HSPD1 Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct HSPH1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct HUWE1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct IDH3B Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT IGHG2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ILF2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct INS Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT IPO7 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct IPO9 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct IRAK1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct IRS4 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ITGB3BP Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ITSN1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT JUNB Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct KDSR Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct KLC1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT KNSTRN Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID KNSTRN two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT KRT16 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct LETM1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct LONP1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct LONP2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct LPXN Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT LSM5 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct MACO1 anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct MAGED1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct MAGED2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct MAP3K12 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MAP3K7 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MAP7D1 anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct MAPK6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 23602568 , 26972000 , (Europe PMC )0.35 BioGRID, IntAct MAPKAPK5 Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, tandem affinity purification, two hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid association, physical, physical association 20936779 , 21900206 , 23602568 , 25416956 , 26972000 , 28514442 , 29426014 , (Europe PMC )0.62, 0.85 BioGRID, IntAct, MINT MARCH7 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct MASP1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MBIP Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct MBOAT7 Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID MBOAT7 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT MCM3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MCM4 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct MCM7 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct MDK Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT METTL13 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct METTL17 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT METTL2A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MGAT1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MIPEP Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MIS18A anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct MLF2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct MOK Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MON1A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MRPL17 anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct MTG2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MYBL2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MYCBP2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct MYO1B anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct MYO9A anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct MYOZ3 Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID MYOZ3 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT MZB1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NAT9 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NAXE Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID NAXE two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT NCOA4 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct NDUFA4 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct NDUFAF4 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct NDUFB10 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct NDUFS3 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct NDUFS6 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NECTIN2 Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID NECTIN2 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT NELFB Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NEURL4 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 22261722 , 23602568 , 26972000 , 28514442 , 29426014 , (Europe PMC )0.35, 0.53 BioGRID, IntAct NOL4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NRXN2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NTPCR anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct NUDT5 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ORM1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID OSTF1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PDCD6IP Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PDLIM1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PFDN6 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PHACTR3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PHC2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PHGDH Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PIH1D1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PIK3R2 anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct PLEKHM1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PLK1 Two-hybrid, anti tag coimmunoprecipitation, two hybrid association, physical, physical association 21900206 , 29426014 , (Europe PMC )0.55 BioGRID, IntAct, MINT PLSCR1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT POLD1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct POLR1A anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct POLR1C anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct POLR2A anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct POLR2B anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct POLR2C anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct POLR2H anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PPBP Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PPFIA1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PPP1R7 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PPP2R1A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PPT1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PRKAB1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PRKAR1A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PRKAR2A anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PRPF38A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PSAT1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PSIP1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PSMA7 Affinity Capture-MS, tandem affinity purification association, physical 23602568 , (Europe PMC )0.35 BioGRID, IntAct PSMB4 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMC1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMC2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMC3 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMC4 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMC5 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMC6 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMD1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMD11 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMD12 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMD13 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMD14 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMD2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMD3 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMD4 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMD6 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSMD7 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSME2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PSME3 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PTOV1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct PTPMT1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RAB2A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RAB31 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RACK1 Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID RACK1 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT RAD23B anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct RAD50 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct RADX anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct RAF1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct RANBP9 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RAP1GAP Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RARA Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RBL1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RGS19 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RIF1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct RNF126 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct RPL10 Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID RPL10 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT RPS27 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct RPS27A anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct RPS27L anti tag coimmunoprecipitation association 26972000 , 29426014 , (Europe PMC )0.53 IntAct RRP7A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RSL1D1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SEPT3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SEPT5 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SERPINA1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SERPINA4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SERPINB4 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SFXN1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SGTA anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SHC1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SLC16A1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SLC1A5 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SLC20A1 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct SLC25A11 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SLC25A13 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SLC25A3 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SLC25A5 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SLC27A4 anti tag coimmunoprecipitation association 26972000 , 29426014 , (Europe PMC )0.53 IntAct SLC41A3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SLC7A1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SMAD6 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SMS Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SNAPC4 Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID SNAPC4 {ECO:0000312|EMBL:CAI13935.1, two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT SNW1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SOCS3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SPART anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SPG7 Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID SPG7 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT SPRR2D Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SPTAN1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SPTLC1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SQSTM1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SRSF5 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SSBP1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SSSCA1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ST7 anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct STK40 Affinity Capture-MS physical 28089446 , (Europe PMC )NA BioGRID STUB1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct STX7 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SUGT1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SUMO2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SUSD4 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT SYAP1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct TCAF1 anti tag coimmunoprecipitation association 26972000 , 29426014 , (Europe PMC )0.53 IntAct TCEAL1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct TCP1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct TDP2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TELO2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct TF Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID THAP4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TM9SF2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct TMBIM6 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct TMCO1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct TMEM165 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct TMPO anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct TOMM20 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct TOR1AIP1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct TPD52 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct TPI1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TRIM25 Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID TRIM33 anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct TRMT2A anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct TTK Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TUBA1A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TUBA1C anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct UBA52 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT UBE2L3 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT UBE3A Affinity Capture-Western, Co-fractionation physical 22645313 , (Europe PMC )NA BioGRID UBE3A anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct UBL4A anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct UBR5 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct UCHL5 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct URB1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT USP20 Affinity Capture-Western, Biochemical Activity physical 28167606 , (Europe PMC )NA BioGRID USP9X anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct VAT1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct VDAC1 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct VDAC2 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct VIM anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct VPS18 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct VPS26C Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID WAPL anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct WDR26 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT WDR34 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT WDR6 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct WFS1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT WWC1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT YTHDF3 anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct ZNF133 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF205 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF28 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZNF281 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ZNF331 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF579 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF600 Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct ZNF671 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF7 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZNF775 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF813 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZNF92 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
CDK1 S684_IGIPQFHsPVGSPLK , S688_QFHSPVGsPLKSIQA , S705_TPSAMKSsPQIPHQT , T698_KSIQATLtPSAMKSS , NA NA PhosphoSitePlus , MAPK6 S189_YSHKGHLsEGLVTKW , LTP, in vitro, in vivo 11741894 , 18669648 , 19651622 , 8621539 ,(Europe PMC )HPRD, PhosphoELM , PhosphoSitePlus , MAPK_group S189_YSHKGHLsEGLVTKW , LTP 8621539 ,(Europe PMC )PhosphoELM , PAK2 S189_YSHKGHLsEGLVTKW , NA NA PhosphoSitePlus , Unknown S189_YSHKGHLsEGLVTKW , S386_QLDPRALsDVTDEEE , S665_EEGFLNNsGEFLFNK , T389_PRALSDVtDEEEVQV , HTP, LTP, in vivo 1741894 , 18669648 , 19664994 ,(Europe PMC )HPRD, PhosphoELM ,