Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
LASP1
Gene Name  | LASP1 (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: 3I35 |
| Synonyms | LASP1, MLN50, | |
| Protein Name | LASP1 | |
| Alternative Name(s) | LIM and SH3 domain protein 1;LASP-1;Metastatic lymph node gene 50 protein;MLN 50; | |
| Protein Family | noSimilarity_annotations | |
| EntrezGene ID | 3927 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q14847 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 29717 Dalton | |
| Protein Length | 261 amino acids (AA) | |
| Genome Browsers | NCBI | | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm, cell cortex Cytoplasm, cytoskeleton Note=Associated with the F-actin rich cortical cytoskeleton | |||
| Function (UniProt annotation) | |||
| Plays an important role in the regulation of dynamicactin-based, cytoskeletal activities Agonist-dependent changes inLASP1 phosphorylation may also serve to regulate actin-associatedion transport activities, not only in the parietal cell but alsoin certain other F-actin-rich secretory epithelial cell types (Bysimilarity) | |||
| Catalytic Activity (UniProt annotation) | |||
| N/A | |||
| Protein Sequence | |||
| MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSEL QSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQ PHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWM YGTVERTGDTGMLPANYVEAI | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0005070 | F:SH3/SH2 adaptor activity |
| GO:0005737 | C:cytoplasm |
| GO:0005925 | C:focal adhesion |
| GO:0006811 | P:ion transport |
| GO:0015075 | F:ion transmembrane transporter activity |
| GO:0030864 | C:cortical actin cytoskeleton |
| GO:0045296 | F:cadherin binding |
| GO:0046872 | F:metal ion binding |
| GO:0051015 | F:actin filament binding |
