Top KIF23
Localization (UniProt annotation) Nucleus Cytoplasm, cytoskeleton, spindleMidbody, Midbody ring Note=Localizes to the interzone of mitotic spindles Detected atthe midbody during later stages of mitotic cytokinesis Function (UniProt annotation) Component of the centralspindlin complex that serves asa microtubule-dependent and Rho-mediated signaling required forthe myosin contractile ring formation during the cell cyclecytokinesis Essential for cytokinesis in Rho-mediated signalingRequired for the localization of ECT2 to the central spindlePlus-end-directed motor enzyme that moves antiparallelmicrotubules in vitro Catalytic Activity (UniProt annotation) N/A Protein Sequence MKSARAKTPRKPTVKKGSQTNLKDPVGVYCRVRPLGFPDQECCIEVINNTTVQLHTPEGYRLNRNGDYKETQYSFKQVFG
THTTQKELFDVVANPLVNDLIHGKNGLLFTYGVTGSGKTHTMTGSPGEGGLLPRCLDMIFNSIGSFQAKRYVFKSNDRNS
MDIQCEVDALLERQKREAMPNPKTSSSKRQVDPEFADMITVQEFCKAEEVDEDSVYGVFVSYIEIYNNYIYDLLEEVPFD
PIKPKPPQSKLLREDKNHNMYVAGCTEVEVKSTEEAFEVFWRGQKKRRIANTHLNRESSRSHSVFNIKLVQAPLDADGDN
VLQEKEQITISQLSLVDLAGSERTNRTRAEGNRLREAGNINQSLMTLRTCMDVLRENQMYGTNKMVPYRDSKLTHLFKNY
FDGEGKVRMIVCVNPKAEDYEENLQVMRFAEVTQEVEVARPVDKAICGLTPGRRYRNQPRGPVGNEPLVTDVVLQSFPPL
PSCEILDINDEQTLPRLIEALEKRHNLRQMMIDEFNKQSNAFKALLQEFDNAVLSKENHMQGKLNEKEKMISGQKLEIER
LEKKNKTLEYKIEILEKTTTIYEEDKRNLQQELETQNQKLQRQFSDKRRLEARLQGMVTETTMKWEKECERRVAAKQLEM
QNKLWVKDEKLKQLKAIVTEPKTEKPERPSRERDREKVTQRSVSPSPVPLSSNYIAQISNGQQLMSQPQLHRRSNSCSSI
SVASCISEWEQKIPTYNTPLKVTSIARRRQQEPGQSKTCIVSDRRRGMYWTEGREVVPTFRNEIEIEEDHCGRLLFQPDQ
NAPPIRLRHRRSRSAGDRWVDHKPASNMQTETVMQPHVPHAITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKGDI
YKTRGGGQSVQFTDIETLKQESPNGSRKRRSSTVAPAQPDGAESEWTDVETRCSVAVEMRAGSQLGPGYQHHAQPKRKKP
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
KIF23 is dephosphorylated by following phosphatases:
Pathway ID Pathway Name Pathway Description (KEGG) hsa05206 MicroRNAs in cancer MicroRNA (miRNA) is a cluster of small non-encoding RNA molecules of 21 - 23 nucleotides in length, which controls gene expression post-transcriptionally either via the degradation of target mRNAs or the inhibition of protein translation. Using high-throughput profiling, dysregulation of miRNAs has been widely observed in different stages of cancer. The upregulation (overexpression) of specific miRNAs could lead to the repression of tumor suppressor gene expression, and conversely the downregulation of specific miRNAs could result in an increase of oncogene expression; both these situations induce subsequent malignant effects on cell proliferation, differentiation, and apoptosis that lead to tumor growth and progress. The miRNA signatures of cancer observed in various studies differ significantly. These inconsistencies occur due to the differences in the study populations and methodologies used. This pathway map shows the summarized results from various studies in 9 cancers, each of which is presented in a review article.
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-2132295 MHC class II antigen presentation. Antigen presenting cells (APCs) such as B cells, dendritic cells (DCs) and monocytes/macrophages express major histocompatibility complex class II molecules (MHC II) at their surface and present exogenous antigenic peptides to CD4+ T helper cells. CD4+ T cells play a central role in immune protection. On their activation they stimulate differentiation of B cells into antibody-producing B-cell blasts and initiate adaptive immune responses. MHC class II molecules are transmembrane glycoprotein heterodimers of alpha and beta subunits. Newly synthesized MHC II molecules present in the endoplasmic reticulum bind to a chaperone protein called invariant (Ii) chain. The binding of Ii prevents the premature binding of self antigens to the nascent MHC molecules in the ER and also guides MHC molecules to endocytic compartments. In the acidic endosomal environment, Ii is degraded in a stepwise manner, ultimately to free the class II peptide-binding groove for loading of antigenic peptides. Exogenous antigens are internalized by the APC by receptor mediated endocytosis, phagocytosis or pinocytosis into endocytic compartments of MHC class II positive cells, where engulfed antigens are degraded in a low pH environment by multiple acidic proteases, generating MHC class II epitopes. Antigenic peptides are then loaded into the class II ligand-binding groove. The resulting class II peptide complexes then move to the cell surface, where they are scanned by CD4+ T cells for specific recognition (Berger & Roche 2009, Zhou & Blum 2004, Watts 2004, Landsverk et al. 2009) R-HSA-6811434 COPI-dependent Golgi-to-ER retrograde traffic. Retrograde traffic from the cis-Golgi to the ERGIC or the ER is mediated in part by microtubule-directed COPI-coated vesicles (Letourneur et al, 1994; Shima et al, 1999; Spang et al, 1998; reviewed in Lord et al, 2013; Spang et al, 2013). These assemble at the cis side of the Golgi in a GBF-dependent fashion and are tethered at the ER by the ER-specific SNAREs and by the conserved NRZ multisubunit tethering complex, known as DSL in yeast (reviewed in Tagaya et al, 2014; Hong and Lev, 2014). Typical cargo of these retrograde vesicles includes 'escaped' ER chaperone proteins, which are recycled back to the ER for reuse by virtue of their interaction with the Golgi localized KDEL receptors (reviewed in Capitani and Sallese, 2009; Cancino et al, 2013) R-HSA-68884 Mitotic Telophase/Cytokinesis. In this final phase of mitosis, new membranes are formed around two sets of chromatids and two daughter cells are formed. The chromosomes and the spindle fibers disperse, and the fiber ring around the center of the cell, composed of actin, contracts, pinching the cell into two daughter cells R-HSA-983189 Kinesins. Kinesins are a superfamily of microtubule-based motor proteins that have diverse functions in transport of vesicles, organelles and chromosomes, and regulate microtubule dynamics. There are 14 families of kinesins, all reprsented in humans. A standardized nomenclature was published in 2004 (Lawrence et al.)
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ARF3 Reconstituted Complex, Two-hybrid physical 10506747 , (Europe PMC )NA BioGRID ARF6 Affinity Capture-Western physical 22522702 , (Europe PMC )NA BioGRID ATP2A2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct BIRC6 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy colocalization, physical, physical association 18329369 , (Europe PMC )0.56 BioGRID, IntAct BRCA1 Affinity Capture-MS, proximity-dependent biotin identification association, physical 26831064 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct CD2AP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CENPA Co-purification physical 15009096 , (Europe PMC )NA BioGRID CEP55 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID CLK1 Biochemical Activity physical 26167880 , (Europe PMC )NA BioGRID DMD Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID DRG1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID EIF2S2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ENO1 Affinity Capture-RNA physical 22658674 , (Europe PMC )NA BioGRID ERC1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct FOXA1 Affinity Capture-MS physical 27926873 , (Europe PMC )NA BioGRID FYCO1 Affinity Capture-MS physical 20562859 , (Europe PMC )NA BioGRID G3BP1 Affinity Capture-MS physical 26777405 , (Europe PMC )NA BioGRID HIST1H2BG Proximity Label-MS physical 25281560 , (Europe PMC )NA BioGRID HIST1H3A Proximity Label-MS, proximity-dependent biotin identification association, physical 25281560 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct HTT Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct IFI16 Affinity Capture-MS physical 25693804 , (Europe PMC )NA BioGRID IKBKG Affinity Capture-Western physical 18511905 , (Europe PMC )NA BioGRID INO80B Affinity Capture-MS physical 28561026 , (Europe PMC )NA BioGRID LATS2 Biochemical Activity physical 25658096 , (Europe PMC )NA BioGRID LIG3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID LIMK1 Affinity Capture-MS, Affinity Capture-Western physical 25786116 , (Europe PMC )NA BioGRID MAP3K4 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID MEAF6 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MICAL3 Affinity Capture-MS, anti tag coimmunoprecipitation, cross-linking study, fluorescence microscopy, pull down association, colocalization, physical, physical association 26496610 , 27528609 , (Europe PMC )0.49, 0.58 BioGRID, IntAct MOV10 Affinity Capture-RNA physical 22658674 , (Europe PMC )NA BioGRID NXF1 Affinity Capture-RNA physical 22658674 , (Europe PMC )NA BioGRID PHLDB2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PKLR Affinity Capture-Western physical 8524282 , (Europe PMC )NA BioGRID PRC1 Affinity Capture-Western, Reconstituted Complex physical 15297875 , (Europe PMC )NA BioGRID PRKCI Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RACGAP1 Affinity Capture-MS, Co-fractionation physical 22939629 , 26344197 , 26496610 , 28514442 , (Europe PMC )NA BioGRID RNMT Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RNPS1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RPGRIP1L Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct SCLT1 Affinity Capture-MS, Proximity Label-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.46 BioGRID, IntAct SFN Affinity Capture-MS, tandem affinity purification physical, physical association 15778465 , (Europe PMC )0.40 BioGRID, IntAct, MINT SH3KBP1 Affinity Capture-MS physical 19531213 , (Europe PMC )NA BioGRID SHCBP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SIRT7 Affinity Capture-MS physical 22586326 , (Europe PMC )NA BioGRID SMNDC1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID STK11 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 14676191 , (Europe PMC )0.35 BioGRID, IntAct TCEA1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID UBE2A Affinity Capture-MS physical 28031328 , (Europe PMC )NA BioGRID USP7 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct USP8 Affinity Capture-Western physical 18329369 , (Europe PMC )NA BioGRID WDR5 Affinity Capture-Western physical 25666610 , (Europe PMC )NA BioGRID XRCC6 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID YWHAB Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation association, physical, physical association 15324660 , 17353931 , 26496610 , (Europe PMC )0.69 BioGRID, IntAct, MINT YWHAE Affinity Capture-MS physical 17979178 , (Europe PMC )NA BioGRID YWHAG Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, pull down association, physical, physical association 15324660 , 17353931 , 20451386 , 25658096 , 26496610 , (Europe PMC )0.76 BioGRID, IntAct, MINT YWHAH Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 14676191 , 17979178 , 26496610 , (Europe PMC )0.64 BioGRID, IntAct YWHAQ Affinity Capture-MS, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 15161933 , 17353931 , (Europe PMC )0.40 BioGRID, IntAct YWHAZ Affinity Capture-MS, anti tag coimmunoprecipitation, pull down, two hybrid association, physical, physical association 14676191 , 15161933 , 20451386 , 22580824 , (Europe PMC )0.79 BioGRID, IntAct, MINT
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ATP2A2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct BIRC6 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy colocalization, physical, physical association 18329369 , (Europe PMC )0.56 BioGRID, IntAct BRCA1 Affinity Capture-MS, proximity-dependent biotin identification association, physical 26831064 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct CD2AP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CEP55 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct ECT2 anti bait coimmunoprecipitation association, physical association 19468300 , 22750944 , (Europe PMC )0.56 IntAct ERC1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct HIST1H3A Proximity Label-MS, proximity-dependent biotin identification association, physical 25281560 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct HTT Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct KIF23 cross-linking study direct interaction 22522702 , (Europe PMC )0.44 IntAct, MINT MICAL3 Affinity Capture-MS, anti tag coimmunoprecipitation, cross-linking study, fluorescence microscopy, pull down association, colocalization, physical, physical association 26496610 , 27528609 , (Europe PMC )0.49, 0.58 BioGRID, IntAct PHLDB2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPP2CA anti bait coimmunoprecipitation association 18201571 , (Europe PMC )0.35 IntAct, MINT PPP2R5E anti bait coimmunoprecipitation association 18201571 , (Europe PMC )0.35 IntAct, MINT RAB11FIP3 anti tag coimmunoprecipitation association 18511905 , (Europe PMC )0.35 IntAct, MINT RACGAP1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, cosedimentation through density gradient, fluorescence microscopy, pull down, two hybrid association, colocalization, physical association 11782313 , 18201571 , 22580824 , 26496610 , (Europe PMC )0.35, 0.82 IntAct, MINT RNASEL anti bait coimmunoprecipitation association 20875083 , (Europe PMC )0.35 IntAct, MINT RNPS1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RPGRIP1L Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct SCLT1 Affinity Capture-MS, Proximity Label-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.46 BioGRID, IntAct SFN Affinity Capture-MS, tandem affinity purification physical, physical association 15778465 , (Europe PMC )0.40 BioGRID, IntAct, MINT SHCBP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct STK11 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 14676191 , (Europe PMC )0.35 BioGRID, IntAct USP7 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct WDR62 anti bait coimmunoprecipitation association 26297806 , (Europe PMC )0.35 IntAct YWHAB Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation association, physical, physical association 15324660 , 17353931 , 26496610 , (Europe PMC )0.69 BioGRID, IntAct, MINT YWHAG Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, pull down association, physical, physical association 15324660 , 17353931 , 20451386 , 25658096 , 26496610 , (Europe PMC )0.76 BioGRID, IntAct, MINT YWHAH Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 14676191 , 17979178 , 26496610 , (Europe PMC )0.64 BioGRID, IntAct YWHAQ Affinity Capture-MS, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 15161933 , 17353931 , (Europe PMC )0.40 BioGRID, IntAct YWHAZ Affinity Capture-MS, anti tag coimmunoprecipitation, pull down, two hybrid association, physical, physical association 14676191 , 15161933 , 20451386 , 22580824 , (Europe PMC )0.79 BioGRID, IntAct, MINT
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source KIF23 cross-linking study direct interaction 22522702 , (Europe PMC )0.44 IntAct, MINT PPP2CA anti bait coimmunoprecipitation association 18201571 , (Europe PMC )0.35 IntAct, MINT PPP2R5E anti bait coimmunoprecipitation association 18201571 , (Europe PMC )0.35 IntAct, MINT RAB11FIP3 anti tag coimmunoprecipitation association 18511905 , (Europe PMC )0.35 IntAct, MINT RACGAP1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, cosedimentation through density gradient, fluorescence microscopy, pull down, two hybrid association, colocalization, physical association 11782313 , 18201571 , 22580824 , 26496610 , (Europe PMC )0.35, 0.82 IntAct, MINT RNASEL anti bait coimmunoprecipitation association 20875083 , (Europe PMC )0.35 IntAct, MINT SFN Affinity Capture-MS, tandem affinity purification physical, physical association 15778465 , (Europe PMC )0.40 BioGRID, IntAct, MINT YWHAB Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation association, physical, physical association 15324660 , 17353931 , 26496610 , (Europe PMC )0.69 BioGRID, IntAct, MINT YWHAG Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, pull down association, physical, physical association 15324660 , 17353931 , 20451386 , 25658096 , 26496610 , (Europe PMC )0.76 BioGRID, IntAct, MINT YWHAZ Affinity Capture-MS, anti tag coimmunoprecipitation, pull down, two hybrid association, physical, physical association 14676191 , 15161933 , 20451386 , 22580824 , (Europe PMC )0.79 BioGRID, IntAct, MINT
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ARF3 Reconstituted Complex, Two-hybrid physical 10506747 , (Europe PMC )NA BioGRID ARF6 Affinity Capture-Western physical 22522702 , (Europe PMC )NA BioGRID ARF6 fluorescence microscopy, pull down, two hybrid association, colocalization, direct interaction, physical association 22522702 , 22580824 , (Europe PMC )0.67 IntAct, MINT ATP2A2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct BIRC6 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy colocalization, physical, physical association 18329369 , (Europe PMC )0.56 BioGRID, IntAct BRCA1 Affinity Capture-MS, proximity-dependent biotin identification association, physical 26831064 , 29656893 , (Europe PMC )0.35 BioGRID, IntAct CD2AP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CENPA Co-purification physical 15009096 , (Europe PMC )NA BioGRID CEP55 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID CEP55 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct CLK1 Biochemical Activity physical 26167880 , (Europe PMC )NA BioGRID DMD Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID DRG1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ECT2 anti bait coimmunoprecipitation association, physical association 19468300 , 22750944 , (Europe PMC )0.56 IntAct EIF2S2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ENO1 Affinity Capture-RNA physical 22658674 , (Europe PMC )NA BioGRID ERC1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct FOXA1 Affinity Capture-MS physical 27926873 , (Europe PMC )NA BioGRID FYCO1 Affinity Capture-MS physical 20562859 , (Europe PMC )NA BioGRID G3BP1 Affinity Capture-MS physical 26777405 , (Europe PMC )NA BioGRID HIST1H2BG Proximity Label-MS physical 25281560 , (Europe PMC )NA BioGRID HIST1H3A Proximity Label-MS, proximity-dependent biotin identification association, physical 25281560 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct HTT Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct IFI16 Affinity Capture-MS physical 25693804 , (Europe PMC )NA BioGRID IKBKG Affinity Capture-Western physical 18511905 , (Europe PMC )NA BioGRID INO80B Affinity Capture-MS physical 28561026 , (Europe PMC )NA BioGRID KIF23 cross-linking study direct interaction 22522702 , (Europe PMC )0.44 IntAct, MINT LATS2 Biochemical Activity physical 25658096 , (Europe PMC )NA BioGRID LIG3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID LIMK1 Affinity Capture-MS, Affinity Capture-Western physical 25786116 , (Europe PMC )NA BioGRID MAP3K4 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID MEAF6 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MICAL3 Affinity Capture-MS, anti tag coimmunoprecipitation, cross-linking study, fluorescence microscopy, pull down association, colocalization, physical, physical association 26496610 , 27528609 , (Europe PMC )0.49, 0.58 BioGRID, IntAct MOV10 Affinity Capture-RNA physical 22658674 , (Europe PMC )NA BioGRID NXF1 Affinity Capture-RNA physical 22658674 , (Europe PMC )NA BioGRID PHLDB2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PKLR Affinity Capture-Western physical 8524282 , (Europe PMC )NA BioGRID PPP2CA anti bait coimmunoprecipitation association 18201571 , (Europe PMC )0.35 IntAct, MINT PPP2R5E anti bait coimmunoprecipitation association 18201571 , (Europe PMC )0.35 IntAct, MINT PRC1 Affinity Capture-Western, Reconstituted Complex physical 15297875 , (Europe PMC )NA BioGRID PRKCI Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RAB11FIP3 anti tag coimmunoprecipitation association 18511905 , (Europe PMC )0.35 IntAct, MINT RACGAP1 Affinity Capture-MS, Co-fractionation physical 22939629 , 26344197 , 26496610 , 28514442 , (Europe PMC )NA BioGRID RACGAP1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, cosedimentation through density gradient, fluorescence microscopy, pull down, two hybrid association, colocalization, physical association 11782313 , 18201571 , 22580824 , 26496610 , (Europe PMC )0.35, 0.82 IntAct, MINT RNASEL anti bait coimmunoprecipitation association 20875083 , (Europe PMC )0.35 IntAct, MINT RNMT Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RNPS1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RPGRIP1L Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct SCLT1 Affinity Capture-MS, Proximity Label-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.46 BioGRID, IntAct SFN Affinity Capture-MS, tandem affinity purification physical, physical association 15778465 , (Europe PMC )0.40 BioGRID, IntAct, MINT SH3KBP1 Affinity Capture-MS physical 19531213 , (Europe PMC )NA BioGRID SHCBP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SIRT7 Affinity Capture-MS physical 22586326 , (Europe PMC )NA BioGRID SMNDC1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID STK11 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 14676191 , (Europe PMC )0.35 BioGRID, IntAct TCEA1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID UBE2A Affinity Capture-MS physical 28031328 , (Europe PMC )NA BioGRID USP7 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct USP8 Affinity Capture-Western physical 18329369 , (Europe PMC )NA BioGRID WDR5 Affinity Capture-Western physical 25666610 , (Europe PMC )NA BioGRID WDR62 anti bait coimmunoprecipitation association 26297806 , (Europe PMC )0.35 IntAct XRCC6 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID YWHAB Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation association, physical, physical association 15324660 , 17353931 , 26496610 , (Europe PMC )0.69 BioGRID, IntAct, MINT YWHAE Affinity Capture-MS physical 17979178 , (Europe PMC )NA BioGRID YWHAG Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, pull down association, physical, physical association 15324660 , 17353931 , 20451386 , 25658096 , 26496610 , (Europe PMC )0.76 BioGRID, IntAct, MINT YWHAH Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 14676191 , 17979178 , 26496610 , (Europe PMC )0.64 BioGRID, IntAct YWHAQ Affinity Capture-MS, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 15161933 , 17353931 , (Europe PMC )0.40 BioGRID, IntAct YWHAZ Affinity Capture-MS, anti tag coimmunoprecipitation, pull down, two hybrid association, physical, physical association 14676191 , 15161933 , 20451386 , 22580824 , (Europe PMC )0.79 BioGRID, IntAct, MINT
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
AURKB S708_IRLRHRRsRSAGDRW , S911_NGSRKRRsSTVAPAQ , NA NA PhosphoSitePlus , Aurora B S714_QPQLHRRsNSCSSIS , LTP 15854913 ,(Europe PMC )PhosphoELM , LATS1 S716_QLHRRSNsCSSISVA , S814_LRHRRSRsAGDRWVD , NA NA PhosphoSitePlus , LATS2 S716_QLHRRSNsCSSISVA , S814_LRHRRSRsAGDRWVD , NA NA PhosphoSitePlus , STK38 S716_QLHRRSNsCSSISVA , S814_LRHRRSRsAGDRWVD , NA NA PhosphoSitePlus , Unknown S125_KTHTMTGsPGEGGLL , S155_AKRYVFKsNDRNSMD , S160_FKSNDRNsMDIQCEV , S18_KPTVKKGsQTNLKDP , S682_REKVTQRsVSPSPVP , S684_KVTQRSVsPSPVPLS , S686_TQRSVSPsPVPLSSN , S708_GQQLMSQsQLHRRSN , S710_QLMSQPQsHRRSNSC , S716_QLHRRSNsCSSISVA , S722_NSCSSISsASCISEW , S763_SKTCIVSsRRRGMYW , S798_CGRLLFQsDQNAPPI , S807_QNAPPIRsRHRRSRS , S808_NAPPIRLsHRRSRSA , S812_IRLRHRRsRSAGDRW , S814_LRHRRSRsAGDRWVD , S826_WVDHKPAsNMQTETV , S830_KPASNMQsETVMQPH , S867_LTHQELAsDGEIETK , S902_IETLKQEsPNGSRKR , S911_NGSRKRRsSTVAPAQ , S912_GSRKRRSsTVAPAQP , S934_TDVETRCsVAVEMRA , S943_AVEMRAGsQLGPGYQ , T450_DKAICGLtPGRRYRN , T679_ERDREKVtQRSVSPS , T738_QKIPTYNtPLKVTSI , T757_QQEPGQStTCIVSDR , T769_SDRRRGMtWTEGREV , T793_IEEDHCGtLLFQPDQ , T809_APPIRLRtRRSRSAG , T861_KCEKYMLtHQELASD , T873_ASDGEIEtKLIKGDI , T897_VQFTDIEtLKQESPN , T8_MKSARAKtPRKPTVK , T913_SRKRRSStVAPAQPD , Y29_LKDPVGVyCRVRPLG , Y736_WEQKIPTyNTPLKVT , HTP, LTP, in vitro, in vivo 15282614 , 15302935 , 15592455 , 15854913 , 16565220 , 16964243 , 17081983 , 17924679 , 18220336 , 18452278 , 18491316 , 18669648 , 18691976 , 19007248 , 19413330 , 19651622 , 19691289 , 20068231 , 22067460 ,(Europe PMC )HPRD, PhosphoELM ,
Statistics
