Top
HOXA10
Localization (UniProt annotation) Nucleus Function (UniProt annotation) Sequence-specific transcription factor which is part ofa developmental regulatory system that provides cells withspecific positional identities on the anterior-posterior axisBinds to the DNA sequence 5'-AA[AT]TTTTATTAC-3' Catalytic Activity (UniProt annotation) N/A Protein Sequence MSARKGYLLPSPNYPTTMSCSESPAANSFLVDSLISSGRGEAGGGGGGAGGGGGGGYYAHGGVYLPPAADLPYGLQSCGL
FPTLGGKRNEAASPGSGGGGGGLGPGAHGYGPSPIDLWLDAPRSCRMEPPDGPPPPPQQQPPPPPQPPQPAPQATSCSFA
QNIKEESSYCLYDSADKCPKVSATAAELAPFPRGPPPDGCALGTSSGVPVPGYFRLSQAYGTAKGYGSGGGGAQQLGAGP
FPAQPPGRGFDLPPALASGSADAARKERALDSPPPPTLACGSGGGSQGDEEAHASSSAAEELSPAPSESSKASPEKDSLG
NSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRI
RELTANFNFS
ELM Motif Motif Instance
Description Motif Regex NA NA NA NA
HOXA10 is dephosphorylated by following phosphatases:
Pathway ID Pathway Name Pathway Description (KEGG) hsa05202 Transcriptional misregulation in cancer In tumor cells, genes encoding transcription factors (TFs) are often amplified, deleted, rearranged via chromosomal translocation and inversion, or subjected to point mutations that result in a gain- or loss-of- function. In hematopoietic cancers and solid tumors, the translocations and inversions increase or deregulate transcription of the oncogene. Recurrent chromosome translocations generate novel fusion oncoproteins, which are common in myeloid cancers and soft-tissue sarcomas. The fusion proteins have aberrant transcriptional function compared to their wild-type counterparts. These fusion transcription factors alter expression of target genes, and thereby result in a variety of altered cellular properties that contribute to the tumourigenic process.
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source COPS5 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CREBBP Reconstituted Complex physical 11585930 , (Europe PMC )NA BioGRID EMX1 Two-hybrid physical 20211142 , (Europe PMC )NA BioGRID FOXB1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXE1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT KAT2B Affinity Capture-Western physical 24037888 , (Europe PMC )NA BioGRID MAPK14 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID NFATC1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT PBX1 Reconstituted Complex physical 14512427 , (Europe PMC )NA BioGRID POLR3D Two-hybrid physical 20211142 , (Europe PMC )NA BioGRID PTPN6 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 12145285 , (Europe PMC )NA BioGRID RBPJ Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT SNAPC1 Two-hybrid physical 20211142 , (Europe PMC )NA BioGRID SPI1 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 18692240 , (Europe PMC )0.52 BioGRID, IntAct TEAD2 Affinity Capture-MS physical 25609649 , (Europe PMC )NA BioGRID TRIM25 Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source FOXE1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT MYC tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct NFATC1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT PTPN11 genetic interference genetic interaction 19022774 , (Europe PMC )0.17 IntAct, MINT RBPJ Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT SPI1 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 18692240 , (Europe PMC )0.52 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source FOXE1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT NFATC1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT PTPN11 genetic interference genetic interaction 19022774 , (Europe PMC )0.17 IntAct, MINT RBPJ Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source COPS5 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CREBBP Reconstituted Complex physical 11585930 , (Europe PMC )NA BioGRID EMX1 Two-hybrid physical 20211142 , (Europe PMC )NA BioGRID FOXB1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXE1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT KAT2B Affinity Capture-Western physical 24037888 , (Europe PMC )NA BioGRID MAPK14 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MYC tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct NFATC1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT PBX1 Reconstituted Complex physical 14512427 , (Europe PMC )NA BioGRID POLR3D Two-hybrid physical 20211142 , (Europe PMC )NA BioGRID PTPN11 genetic interference genetic interaction 19022774 , (Europe PMC )0.17 IntAct, MINT PTPN6 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 12145285 , (Europe PMC )NA BioGRID RBPJ Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT SNAPC1 Two-hybrid physical 20211142 , (Europe PMC )NA BioGRID SPI1 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 18692240 , (Europe PMC )0.52 BioGRID, IntAct TEAD2 Affinity Capture-MS physical 25609649 , (Europe PMC )NA BioGRID TRIM25 Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
Unknown Y27_CSESPAAySFLVDSL , Y326_GRKKRCPyTKHQTLE , Y343_KEFLFNMyLTRERRL , Y360_KEFLFNMyLTRERRL , Y44_SGRGEAGyGGGGAGG , LTP, in vitro, in vivo 12145285 ,(Europe PMC )HPRD, PhosphoELM ,