- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
EIF2AK2
Gene Name  | EIF2AK2 (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: 3UIU |
| Synonyms | EIF2AK2, PKR, PRKR | |
| Protein Name | EIF2AK2 | |
| Alternative Name(s) | Interferon-induced, double-stranded RNA-activated protein kinase;2.7.11.1;Eukaryotic translation initiation factor 2-alpha kinase 2;eIF-2A protein kinase 2;Interferon-inducible RNA-dependent protein kinase;P1/eIF-2A protein kinase;Protein kinase RNA-activated;PKR;Protein kinase R;Tyrosine-protein kinase EIF2AK2;2.7.10.2;p68 kinase; | |
| Protein Family | Belongs to the protein kinase superfamily Ser/Thrprotein kinase family GCN2 subfamily | |
| EntrezGene ID | 5610 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P19525 (protein sequence) | |
| Enzyme Class | 2.7.11.1 2.7.10.2 (BRENDA ) | |
| Molecular Weight | 62094 Dalton | |
| Protein Length | 551 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000055332 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - KOG1033 | eggNOG - ENOG410XS0B | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm Nucleus Cytoplasm, perinuclearregion Note=Nuclear localization is elevated in acute leukemia,myelodysplastic syndrome (MDS), melanoma, breast, colon, prostateand lung cancer patient samples or cell lines as well asneurocytes from advanced Creutzfeldt-Jakob disease patients | |||
| Function (UniProt annotation) | |||
| IFN-induced dsRNA-dependent serine/threonine-proteinkinase which plays a key role in the innate immune response toviral infection and is also involved in the regulation of signaltransduction, apoptosis, cell proliferation and differentiationExerts its antiviral activity on a wide range of DNA and RNAviruses including hepatitis C virus (HCV), hepatitis B virus(HBV), measles virus (MV) and herpes simplex virus 1 (HHV-1)Inhibits viral replication via phosphorylation of the alphasubunit of eukaryotic initiation factor 2 (EIF2S1), thisphosphorylation impairs the recycling of EIF2S1 between successiverounds of initiation leading to inhibition of translation whicheventually results in shutdown of cellular and viral proteinsynthesis Also phosphorylates other substrates includingp53/TP53, PPP2R5A, DHX9, ILF3, IRS1 and the HHV-1 viral proteinUS11 In addition to serine/threonine-protein kinase activity,also has tyrosine-protein kinase activity and phosphorylates CDK1at 'Tyr-4' upon DNA damage, facilitating its ubiquitination andproteosomal degradation Either as an adapter protein and/or viaits kinase activity, can regulate various signaling pathways (p38MAP kinase, NF-kappa-B and insulin signaling pathways) andtranscription factors (JUN, STAT1, STAT3, IRF1, ATF3) involved inthe expression of genes encoding proinflammatory cytokines andIFNs Activates the NF-kappa-B pathway via interaction with IKBKBand TRAF family of proteins and activates the p38 MAP kinasepathway via interaction with MAP2K6 Can act as both a positiveand negative regulator of the insulin signaling pathway (ISP)Negatively regulates ISP by inducing the inhibitoryphosphorylation of insulin receptor substrate 1 (IRS1) at 'Ser-312' and positively regulates ISP via phosphorylation of PPP2R5Awhich activates FOXO1, which in turn up-regulates the expressionof insulin receptor substrate 2 (IRS2) Can regulate NLRP3inflammasome assembly and the activation of NLRP3, NLRP1, AIM2 andNLRC4 inflammasomes Can trigger apoptosis via FADD-mediatedactivation of CASP8 Plays a role in the regulation of thecytoskeleton by binding to gelsolin (GSN), sequestering theprotein in an inactive conformation away from actin | |||
| Catalytic Activity (UniProt annotation) | |||
| ATP + a protein = ADP + a phosphoprotein ATP + a [protein]-L-tyrosine = ADP + a[protein]-L-tyrosine phosphate | |||
| Protein Sequence | |||
| MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKK AVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKL AYLQILSEETSVKSDYLSSGSFATTCESQSNSLVTSTLASESSSEGDFSADTSEINSNSDSLNSSSLLMNGLRNNQRKAK RSLAPRFDLPDMKETKYTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKYNNEKAEREVKALAKLDHVNI VHYNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITK GVDYIHSKKLIHRDLKPSNIFLVDTKQVKIGDFGLVTSLKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAE LLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWKKSPEKNERHTC | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000186 | P:activation of MAPKK activity |
| GO:0001819 | P:positive regulation of cytokine production |
| GO:0003723 | F:RNA binding |
| GO:0003725 | F:double-stranded RNA binding |
| GO:0004672 | F:protein kinase activity |
| GO:0004674 | F:protein serine/threonine kinase activity |
| GO:0004694 | F:eukaryotic translation initiation factor 2alpha kinase activity |
| GO:0004715 | F:non-membrane spanning protein tyrosine kinase activity |
| GO:0005524 | F:ATP binding |
| GO:0005634 | C:nucleus |
| GO:0005737 | C:cytoplasm |
| GO:0005829 | C:cytosol |
| GO:0005840 | C:ribosome |
| GO:0006351 | P:transcription |
| GO:0006412 | DNA-templated |
| GO:0006468 | P:translation |
| GO:0008285 | P:protein phosphorylation |
| GO:0009615 | P:negative regulation of cell proliferation |
| GO:0009636 | P:response to virus |
| GO:0016020 | P:response to toxic substance |
| GO:0017148 | C:membrane |
| GO:0019888 | P:negative regulation of translation |
| GO:0030683 | F:protein phosphatase regulator activity |
| GO:0030968 | P:evasion or tolerance by virus of host immune response |
| GO:0032722 | P:endoplasmic reticulum unfolded protein response |
| GO:0032874 | P:positive regulation of chemokine production |
| GO:0033689 | P:positive regulation of stress-activated MAPK cascade |
| GO:0034198 | P:negative regulation of osteoblast proliferation |
| GO:0035455 | P:cellular response to amino acid starvation |
| GO:0042802 | P:response to interferon-alpha |
| GO:0043066 | F:identical protein binding |
| GO:0045071 | P:negative regulation of apoptotic process |
| GO:0045087 | P:negative regulation of viral genome replication |
| GO:0046777 | P:innate immune response |
| GO:0048471 | P:protein autophosphorylation |
| GO:0051092 | C:perinuclear region of cytoplasm |
| GO:0051607 | P:positive regulation of NF-kappaB transcription factor activity |
| GO:1900225 | P:defense response to virus |
| GO:1901224 | P:regulation of NLRP3 inflammasome complex assembly |
| GO:1901532 | P:positive regulation of NIK/NF-kappaB signaling |
| GO:1902033 | P:regulation of hematopoietic progenitor cell differentiation |
| GO:1902036 | P:regulation of hematopoietic stem cell proliferation |
EIF2AK2 is dephosphorylated by following phosphatases:
| Phosphatase Gene Name | Phosphatase UniProt_AC | DephosphoSite and sequence (+/-5) in EIF2AK2 (P19525) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| PPP1CA | P62136 | NA | In vitro and in vivo | 12138106, | Europe PMC |  |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| hsa04141 | Protein processing in endoplasmic reticulum | The endoplasmic reticulum (ER) is a subcellular organelle where proteins are folded with the help of lumenal chaperones. Newly synthesized peptides enter the ER via the sec61 pore and are glycosylated. Correctly folded proteins are packaged into transport vesicles that shuttle them to the Golgi complex. Misfolded proteins are retained within the ER lumen in complex with molecular chaperones. Proteins that are terminally misfolded bind to BiP and are directed toward degradation through the proteasome in a process called ER-associated degradation (ERAD). Accumulation of misfolded proteins in the ER causes ER stress and activates a signaling pathway called the unfolded protein response (UPR). In certain severe situations, however, the protective mechanisms activated by the UPR are not sufficient to restore normal ER function and cells die by apoptosis. |
| hsa04217 | Necroptosis | Necroptosis is a programmed form of necrosis. It can be initiated by different stimuli, such as tumor necrosis factor (TNF), TNF-related apoptosis-inducing ligand (TRAIL), Fas ligand (FasL), interferon (IFN), LPS, viral DNA or RNA, DNA-damage agent and requires the kinase activity of receptor-interacting protein 1 (RIPK1) and RIPK3. Its execution involves ROS generation, calcium overload, the opening of the mitochondrial permeability transition pore, mitochondrial fission, inflammatory response and chromatinolysis. Necroptosis participates in many pathogenesis of diseases, including neurological diseases, retinal disorders, acute kidney injury, inflammatory diseases and microbial infections. |
| hsa05160 | Hepatitis C | Hepatitis C virus (HCV) is a major cause of chronic liver disease. The HCV employ several strategies to perturb host cell immunity. After invasion, HCV RNA genome functions directly as an mRNA in the cytoplasm of the host cell and forms membrane-associated replication complexes along with non-structural proteins. Viral RNA can trigger the RIG-I pathway and interferon production during this process. Translated HCV protein products regulate immune response to inhibit the action of interferon. HCV core and NS5A proteins appear to be the most important molecules with regulatory functions that modulate transcription, cellular proliferation, and apoptosis. |
| hsa05162 | Measles | Measles virus (MV) is highly contagious virus that leads infant death worldwide. Humans are the unique natural reservoir for this virus. It causes severe immunosuppression favouring secondary bacterial infections. Several MV proteins have been suggested to disturb host immunity. After infection of host lymphoid cells via SLAM, MV inhibits cytokine response by direct interference with host signaling systems. Three proteins (P, V, and C) associate with Jak/STAT proteins in interferon-triggered pathway and other important proteins related to apoptosis. Interaction between MV and host brings about the shift towards a Th2 response by decreasing IL-12 production and induces lymphopenia by suppressing cell proliferation. |
| hsa05164 | Influenza A | Influenza is a contagious respiratory disease caused by influenza virus infection. Influenza A virus is responsible for both annual seasonal epidemics and periodic worldwide pandemics. Novel strains that cause pandemics arise from avian influenza virus by genetic reassortment among influenza viruses and two surface glycoproteins HA and NA form the basis of serologically distinct virus types. The innate immune system recognizes invaded virus through multiple mechanisms. Viral non-structural NS1 protein is a multifunctional virulence factor that interfere IFN-mediated antiviral response. It inhibits IFN production by blocking activation of transcription factors such as NF-kappa B, IRF3 and AP1. NS1 further inhibits the activation of IFN-induced antiviral genes. PB1-F2 protein is another virulence factor that induce apoptosis of infected cells, which results in life-threatening bronchiolitis. |
| hsa05165 | Human papillomavirus infection | Human papillomavirus (HPV) is a non-enveloped, double-stranded DNA virus. HPV infect mucoal and cutaneous epithelium resulting in several types of pathologies, most notably, cervical cancer. All types of HPV share a common genomic structure and encode eight proteins: E1, E2, E4, E5, E6, and E7 (early) and L1 and L2 (late). It has been demonstrated that E1 and E2 are involved in viral transcription and replication. The functions of the E4 protein is not yet fully understood. E5, E6, and E7 act as oncoproteins. E5 inhibits the V-ATPase, prolonging EGFR signaling and thereby promoting cell proliferation. The expression of E6 and E7 not only inhibits the tumor suppressors p53 and Rb, but also alters additional signalling pathways. Among these pathways, PI3K/Akt signalling cascade plays a very important role in HPV-induced carcinogenesis. The L1 and L2 proteins form icosahedral capsids for progeny virion generation. |
| hsa05167 | Kaposi sarcoma-associated herpesvirus infection | Kaposi sarcoma-associated herpesvirus (KSHV), also known as human herpesvirus 8 (HHV-8), is the most recently identified human tumor virus, and is associated with the pathogenesis of Kaposi's sarcoma (KS), primary effusion lymphoma (PEL), and Multicentric Castleman's disease (MCD). Like all other herpesviruses, KSHV displays two modes of life cycle, latency and lytic replication, which are characterized by the patterns of viral gene expression. Genes expressed in latency (LANA, v-cyclin, v-FLIP, Kaposins A, B and C and viral miRNAs) are mainly thought to facilitate the establishment of life long latency in its host and survival against the host innate, and adaptive immune surveillance mechanisms. Among the viral proteins shown to be expressed during lytic replication are potent signaling molecules such as vGPCR, vIL6, vIRFs, vCCLs, K1 and K15, which have been implicated experimentally in the angiogenic and inflammatory phenotype observed in KS lesions. Several of these latent viral and lytic proteins are known to transform host cells, linking KSHV with the development of severe human malignancies. |
| hsa05168 | Herpes simplex infection | Herpes simplex virus (HSV) infections are very common worldwide, with the prevalence of HSV-1 reaching up to 80%-90%. Primary infection with HSV takes place in the mucosa, followed by the establishment of latent infection in neuronal ganglia. HSV is the main cause of herpes infections that lead to the formation of characteristic blistering lesion. HSV express multiple viral accessory proteins that interfere with host immune responses and are indispensable for viral replication. Among these proteins, the immediate early (IE) gene ICP0, ICP4, and ICP27 are essential for regulation of HSV gene expression in productive infection. On the other hand, ORF P and ORF O gene are transcribed during latency and blocks the expression of the IE genes, thus maintaining latent infection. |
| hsa05169 | Epstein-Barr virus infection | Epstein-Barr virus (EBV) is a gamma-herpes virus that widely infects human populations predominantly at an early age but remains mostly asymptomatic. EBV has been linked to a wide spectrum of human malignancies, including nasopharyngeal carcinoma and other hematologic cancers, like Hodgkin's lymphoma, Burkitt's lymphoma (BL), B-cell immunoblastic lymphoma in HIV patients, and posttransplant-associated lymphoproliferative diseases. EBV has the unique ability to establish life-long latent infection in primary human B lymphocytes. During latent infection, EBV expresses a small subset of genes, including 6 nuclear antigens (EBNA-1, -2, -3A, -3B, -3C, and -LP), 3 latent membrane proteins (LMP-1, -2A, and -2B), 2 small noncoding RNAs (EBER-1 and 2). On the basis of these latent gene expression, three different latency patterns associated with the types of cancers are recognized. |
| hsa05203 | Viral carcinogenesis | There is a strong association between viruses and the development of human malignancies. We now know that at least six human viruses, Epstein-Barr virus (EBV), hepatitis B virus (HBV), hepatitis C virus (HCV), human papilloma virus (HPV), human T-cell lymphotropic virus (HTLV-1) and Kaposi's associated sarcoma virus (KSHV) contribute to 10-15% of the cancers worldwide. Via expression of many potent oncoproteins, these tumor viruses promote an aberrant cell-proliferation via modulating cellular cell-signaling pathways and escape from cellular defense system such as blocking apoptosis. Human tumor virus oncoproteins can also disrupt pathways that are necessary for the maintenance of the integrity of host cellular genome. Viruses that encode such activities can contribute to initiation as well as progression of human cancers. |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-1169408 | ISG15 antiviral mechanism. | Interferon-stimulated gene 15 (ISG15) is a member of the ubiquitin-like (Ubl) family. It is strongly induced upon exposure to type I Interferons (IFNs), viruses, bacterial LPS, and other stresses. Once released the mature ISG15 conjugates with an array of target proteins, a process termed ISGylation. ISGylation utilizes a mechanism similar to ubiquitination, requiring a three-step enzymatic cascade. UBE1L is the ISG15 E1 activating enzyme which specifically activates ISG15 at the expense of ATP. ISG15 is then transfered from E1 to the E2 conjugating enzyme UBCH8 and then to the target protein with the aid of an ISG15 E3 ligase, such as HERC5 and EFP. Hundreds of target proteins for ISGylation have been identified. Several proteins that are part of antiviral signaling pathways, such as RIG-I, MDA5, Mx1, PKR, filamin B, STAT1, IRF3 and JAK1, have been identified as targets for ISGylation. ISG15 also conjugates some viral proteins, inhibiting viral budding and release. ISGylation appears to act either by disrupting the activity of a target protein and/or by altering its localization within the cell |
| R-HSA-169131 | Inhibition of PKR. | The key role played by PKR in the innate response to virus infection is emphasized by the large number of viruses that encode PKR inhibitors |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| CAND1 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CCDC124 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CCNA2 | Affinity Capture-MS | physical | 21903422, 26186194, (Europe PMC) | NA | BioGRID |
| CDC37 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDCA5 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDK3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CHMP4B | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CHUK | Affinity Capture-Western | physical | 10723127, 10848580, (Europe PMC) | NA | BioGRID |
| COX15 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CUL3 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CYP1A1 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| DBNL | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| DHX30 | Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation, tandem affinity purification | association, physical, physical association | 21903422, 23455922, (Europe PMC) | 0.62 | BioGRID, IntAct |
| DHX58 | Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical, physical association | 21903422, (Europe PMC) | 0.50 | BioGRID, IntAct |
| DHX9 | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex | physical | 19229320, 21903422, (Europe PMC) | NA | BioGRID |
| DICER1 | Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical, physical association | 21903422, (Europe PMC) | 0.50 | BioGRID, IntAct |
| DLD | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DLST | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DNAJC3 | Reconstituted Complex, Two-hybrid | physical | 8576172, 9447982, (Europe PMC) | NA | BioGRID |
| EBNA1BP2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EDC4 | Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical, physical association | 21903422, (Europe PMC) | 0.50 | BioGRID, IntAct |
| EGFR | Affinity Capture-MS | physical | 24797263, (Europe PMC) | NA | BioGRID |
| EIF2A | Affinity Capture-Western | physical | 19229320, (Europe PMC) | NA | BioGRID |
| EIF2AK2 | Affinity Capture-Western, Biochemical Activity, Far Western, Two-hybrid, far western blotting, protein kinase assay | direct interaction, phosphorylation reaction, physical | 10848580, 11447118, 12882984, 16373505, 18082144, 7568151, (Europe PMC) | 0.56 | BioGRID, IntAct |
| EIF2S1 | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, competition binding, protein kinase assay, pull down | direct interaction, phosphorylation reaction, physical, physical association | 12882984, 16288713, 17290288, 18971339, 19364808, 21368187, 9431994, (Europe PMC) | 0.78 | BioGRID, IntAct, MINT |
| EIF6 | Affinity Capture-MS, Reconstituted Complex | physical | 21903422, (Europe PMC) | NA | BioGRID |
| ELAVL1 | Affinity Capture-RNA | physical | 19322201, (Europe PMC) | NA | BioGRID |
| ELMSAN1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FANCC | Affinity Capture-Western | physical | 12397061, 15299030, (Europe PMC) | NA | BioGRID |
| FARSA | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FARSB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FTSJ3 | Affinity Capture-MS, Reconstituted Complex | physical | 21903422, (Europe PMC) | NA | BioGRID |
| GNL3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GPX7 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| GTPBP4 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HDGF | Affinity Capture-MS | physical | 21907836, (Europe PMC) | NA | BioGRID |
| HECW2 | Affinity Capture-MS | physical | 24163370, (Europe PMC) | NA | BioGRID |
| HIST1H1C | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HIST1H2AB | Biochemical Activity | physical | 20484669, (Europe PMC) | NA | BioGRID |
| HIST2H2AC | Biochemical Activity | physical | 9447982, (Europe PMC) | NA | BioGRID |
| HNRNPC | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HNRNPCL1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HSP90AA1 | Affinity Capture-Luminescence, Affinity Capture-Western | physical | 11447118, 22939624, (Europe PMC) | NA | BioGRID |
| IFI16 | Affinity Capture-MS | physical | 25693804, (Europe PMC) | NA | BioGRID |
| IFRD1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IGF2BP2 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IGF2BP3 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IKBKB | Affinity Capture-Western | physical | 10848580, (Europe PMC) | NA | BioGRID |
| IL7R | Protein-RNA | physical | 23151878, (Europe PMC) | NA | BioGRID |
| ILF2 | Biochemical Activity | physical | 11438540, (Europe PMC) | NA | BioGRID |
| ILF3 | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid | physical | 10320367, 10400669, 11438536, 11438540, (Europe PMC) | NA | BioGRID |
| IQCF1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ISG15 | Affinity Capture-MS | physical | 16009940, (Europe PMC) | NA | BioGRID |
| JAK1 | Affinity Capture-Western | physical | 17290288, (Europe PMC) | NA | BioGRID |
| KCTD17 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LMNA | Affinity Capture-MS | physical | 12882984, (Europe PMC) | NA | BioGRID |
| LYAR | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MACROD1 | Affinity Capture-MS | physical | 25735744, (Europe PMC) | NA | BioGRID |
| MAP3K5 | Affinity Capture-Western | physical | 12473108, (Europe PMC) | NA | BioGRID |
| MAP3K7 | Affinity Capture-Western | physical | 12609980, (Europe PMC) | NA | BioGRID |
| MAVS | Affinity Capture-Western | physical | 22022264, (Europe PMC) | NA | BioGRID |
| MCM2 | Affinity Capture-MS | physical | 25963833, (Europe PMC) | NA | BioGRID |
| MECP2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| METAP2 | Affinity Capture-Western, Reconstituted Complex | physical | 11123929, (Europe PMC) | NA | BioGRID |
| MIR1-1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR1-2 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR106A | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR106B | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR107 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR10B | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR122 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR128-1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR128-2 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR138-1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR138-2 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR140 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR141 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR143 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR145 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR155 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR15A | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR15B | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR16-1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR16-2 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR17 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR18A | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR18B | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR199A1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR199A2 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR19A | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR19B1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR19B2 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR200A | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR200B | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR200C | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR205 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR206 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR20A | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR20B | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR21 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR214 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR221 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR222 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR25 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR29A | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR29B1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR29B2 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR29C | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR31 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR34A | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR34B | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR34C | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR363 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR429 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR451A | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR7-1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR7-2 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR7-3 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR9-1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR9-2 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR9-3 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR92A1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR92A2 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR93 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR98 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7A1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7A2 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7A3 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7B | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7C | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7D | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7E | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7F1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7F2 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7G | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7I | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MOV10 | Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical, physical association | 21903422, (Europe PMC) | 0.50 | BioGRID, IntAct |
| NOC3L | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NOP2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NOP53 | Affinity Capture-MS | physical | 21903422, (Europe PMC) | NA | BioGRID |
| NPM1 | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, imaging technique | colocalization, physical, physical association | 12882984, 16957780, (Europe PMC) | 0.46 | BioGRID, IntAct, MINT |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| PABPC4 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PDGFRB | Affinity Capture-Western | physical | 11350938, (Europe PMC) | NA | BioGRID |
| PPP1CA | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex | physical | 12138106, (Europe PMC) | NA | BioGRID |
| PPP1CC | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PPP2R5A | Affinity Capture-Western | physical | 10866685, (Europe PMC) | NA | BioGRID |
| PRKRA | Affinity Capture-MS, Affinity Capture-Western, Phenotypic Enhancement, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, nuclear magnetic resonance, pull down, tandem affinity purification, two hybrid array, two hybrid prey pooling approach | association, direct interaction, genetic, physical, physical association | 11985496, 16785445, 21903422, 23455922, 24778252, 9687506, (Europe PMC) | 0.54, 0.71 | BioGRID, IntAct |
| PRKRIP1 | Affinity Capture-Western | physical | 12679338, (Europe PMC) | NA | BioGRID |
| PTEN | Affinity Capture-Western | physical | 20029030, (Europe PMC) | NA | BioGRID |
| PTGES3 | Affinity Capture-Western | physical | 11447118, (Europe PMC) | NA | BioGRID |
| PURA | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPL10 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| RPL6 | Affinity Capture-MS | physical | 12882984, (Europe PMC) | NA | BioGRID |
| RPLP0 | Affinity Capture-MS | physical | 12882984, (Europe PMC) | NA | BioGRID |
| RPS2 | Affinity Capture-MS | physical | 12882984, (Europe PMC) | NA | BioGRID |
| RPS3A | Affinity Capture-MS | physical | 12882984, (Europe PMC) | NA | BioGRID |
| SCARB2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SSB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STAT1 | Affinity Capture-Western, Reconstituted Complex | physical | 11278865, 9135145, (Europe PMC) | NA | BioGRID |
| STAT3 | Affinity Capture-Western | physical | 11350938, (Europe PMC) | NA | BioGRID |
| STAU1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STAU2 | Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical, physical association | 21903422, 24778252, (Europe PMC) | 0.50 | BioGRID, IntAct |
| TARBP2 | Affinity Capture-MS, Far Western, Reconstituted Complex, Two-hybrid | physical | 11438532, 21903422, 7568151, (Europe PMC) | NA | BioGRID |
| THAP12 | Affinity Capture-Western | physical | 20484669, (Europe PMC) | NA | BioGRID |
| TOLLIP | Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical, physical association | 21903422, (Europe PMC) | 0.50 | BioGRID, IntAct |
| TOP1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TP53 | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex | physical | 10348343, 19631745, (Europe PMC) | NA | BioGRID |
| TRAF2 | Affinity Capture-Western | physical | 15121867, 25715336, (Europe PMC) | NA | BioGRID |
| TRAF5 | Affinity Capture-Western | physical | 15121867, (Europe PMC) | NA | BioGRID |
| TRAF6 | Affinity Capture-Western | physical | 15121867, 25715336, (Europe PMC) | NA | BioGRID |
| TYK2 | Affinity Capture-Western, Reconstituted Complex | physical | 17290288, (Europe PMC) | NA | BioGRID |
| XRN2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ZNF346 | Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical, physical association | 21903422, (Europe PMC) | 0.50 | BioGRID, IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| CCDC124 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CCNA2 | anti tag coimmunoprecipitation | association | 21903422, (Europe PMC) | 0.35 | IntAct |
| CDC37 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDC42 | pull down | direct interaction | 7738010, (Europe PMC) | 0.44 | IntAct, MINT |
| CDCA5 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDK1 | protein kinase assay | phosphorylation reaction | 20395957, (Europe PMC) | 0.44 | IntAct, MINT |
| CDK3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CHMP4B | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| COX15 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DBNL | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| DHX30 | Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation, tandem affinity purification | association, physical, physical association | 21903422, 23455922, (Europe PMC) | 0.62 | BioGRID, IntAct |
| DHX58 | Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical, physical association | 21903422, (Europe PMC) | 0.50 | BioGRID, IntAct |
| DHX9 | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | association, physical association | 21903422, (Europe PMC) | 0.50 | IntAct |
| DICER1 | Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical, physical association | 21903422, (Europe PMC) | 0.50 | BioGRID, IntAct |
| DLD | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DLST | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EBNA1BP2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EDC4 | Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical, physical association | 21903422, (Europe PMC) | 0.50 | BioGRID, IntAct |
| EIF2AK2 | Affinity Capture-Western, Biochemical Activity, Far Western, Two-hybrid, far western blotting, protein kinase assay | direct interaction, phosphorylation reaction, physical | 10848580, 11447118, 12882984, 16373505, 18082144, 7568151, (Europe PMC) | 0.56 | BioGRID, IntAct |
| EIF2S1 | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, competition binding, protein kinase assay, pull down | direct interaction, phosphorylation reaction, physical, physical association | 12882984, 16288713, 17290288, 18971339, 19364808, 21368187, 9431994, (Europe PMC) | 0.78 | BioGRID, IntAct, MINT |
| EIF6 {ECO:0000255|HAMAP-Rule:MF_03132, | anti tag coimmunoprecipitation | association, physical association | 21903422, (Europe PMC) | 0.50 | IntAct |
| ELMSAN1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FARSA | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FARSB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FTSJ3 | anti tag coimmunoprecipitation | association, physical association | 21903422, (Europe PMC) | 0.50 | IntAct |
| GABARAPL2 | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GNL3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GTPBP4 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HIST1H1C | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HNRNPC | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HNRNPCL1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HSP90AB1 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| IFRD1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IGF2BP2 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IGF2BP3 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| KCTD17 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LYAR | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MOV10 | Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical, physical association | 21903422, (Europe PMC) | 0.50 | BioGRID, IntAct |
| NLRC4 | anti tag coimmunoprecipitation | physical association | 22801494, (Europe PMC) | 0.40 | IntAct |
| NLRP1 | anti tag coimmunoprecipitation | physical association | 22801494, (Europe PMC) | 0.40 | IntAct |
| NLRP3 | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | direct interaction, physical association | 22801494, (Europe PMC) | 0.60 | IntAct |
| NOC3L | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NOP2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NOP53 | anti tag coimmunoprecipitation | association | 21903422, (Europe PMC) | 0.35 | IntAct |
| NPM1 | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, imaging technique | colocalization, physical, physical association | 12882984, 16957780, (Europe PMC) | 0.46 | BioGRID, IntAct, MINT |
| PABPC4 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PPP1CC | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PRKRA | Affinity Capture-MS, Affinity Capture-Western, Phenotypic Enhancement, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, nuclear magnetic resonance, pull down, tandem affinity purification, two hybrid array, two hybrid prey pooling approach | association, direct interaction, genetic, physical, physical association | 11985496, 16785445, 21903422, 23455922, 24778252, 9687506, (Europe PMC) | 0.54, 0.71 | BioGRID, IntAct |
| PURA | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPL10 | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| SCARB2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SSB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STAU1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STAU2 | Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical, physical association | 21903422, 24778252, (Europe PMC) | 0.50 | BioGRID, IntAct |
| TARBP2 | anti tag coimmunoprecipitation | association, physical association | 21903422, (Europe PMC) | 0.50 | IntAct |
| TOLLIP | Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical, physical association | 21903422, (Europe PMC) | 0.50 | BioGRID, IntAct |
| TOP1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| XRN2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ZNF346 | Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical, physical association | 21903422, (Europe PMC) | 0.50 | BioGRID, IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| CDK1 | protein kinase assay | phosphorylation reaction | 20395957, (Europe PMC) | 0.44 | IntAct, MINT |
| EIF2S1 | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, competition binding, protein kinase assay, pull down | direct interaction, phosphorylation reaction, physical, physical association | 12882984, 16288713, 17290288, 18971339, 19364808, 21368187, 9431994, (Europe PMC) | 0.78 | BioGRID, IntAct, MINT |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| NPM1 | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, imaging technique | colocalization, physical, physical association | 12882984, 16957780, (Europe PMC) | 0.46 | BioGRID, IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ATP6V1F | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| CAND1 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CCDC124 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CCNA2 | Affinity Capture-MS | physical | 21903422, 26186194, (Europe PMC) | NA | BioGRID |
| CCNA2 | anti tag coimmunoprecipitation | association | 21903422, (Europe PMC) | 0.35 | IntAct |
| CDC37 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDC42 | pull down | direct interaction | 7738010, (Europe PMC) | 0.44 | IntAct, MINT |
| CDCA5 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDK1 | protein kinase assay | phosphorylation reaction | 20395957, (Europe PMC) | 0.44 | IntAct, MINT |
| CDK3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CHMP4B | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CHUK | Affinity Capture-Western | physical | 10723127, 10848580, (Europe PMC) | NA | BioGRID |
| COX15 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CUL3 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CYP1A1 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| DBNL | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| DHX30 | Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation, tandem affinity purification | association, physical, physical association | 21903422, 23455922, (Europe PMC) | 0.62 | BioGRID, IntAct |
| DHX58 | Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical, physical association | 21903422, (Europe PMC) | 0.50 | BioGRID, IntAct |
| DHX9 | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex | physical | 19229320, 21903422, (Europe PMC) | NA | BioGRID |
| DHX9 | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | association, physical association | 21903422, (Europe PMC) | 0.50 | IntAct |
| DICER1 | Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical, physical association | 21903422, (Europe PMC) | 0.50 | BioGRID, IntAct |
| DLD | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DLST | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DNAJC3 | Reconstituted Complex, Two-hybrid | physical | 8576172, 9447982, (Europe PMC) | NA | BioGRID |
| EBNA1BP2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EDC4 | Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical, physical association | 21903422, (Europe PMC) | 0.50 | BioGRID, IntAct |
| EGFR | Affinity Capture-MS | physical | 24797263, (Europe PMC) | NA | BioGRID |
| EIF2A | Affinity Capture-Western | physical | 19229320, (Europe PMC) | NA | BioGRID |
| EIF2AK2 | Affinity Capture-Western, Biochemical Activity, Far Western, Two-hybrid, far western blotting, protein kinase assay | direct interaction, phosphorylation reaction, physical | 10848580, 11447118, 12882984, 16373505, 18082144, 7568151, (Europe PMC) | 0.56 | BioGRID, IntAct |
| EIF2S1 | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, competition binding, protein kinase assay, pull down | direct interaction, phosphorylation reaction, physical, physical association | 12882984, 16288713, 17290288, 18971339, 19364808, 21368187, 9431994, (Europe PMC) | 0.78 | BioGRID, IntAct, MINT |
| EIF6 | Affinity Capture-MS, Reconstituted Complex | physical | 21903422, (Europe PMC) | NA | BioGRID |
| EIF6 {ECO:0000255|HAMAP-Rule:MF_03132, | anti tag coimmunoprecipitation | association, physical association | 21903422, (Europe PMC) | 0.50 | IntAct |
| ELAVL1 | Affinity Capture-RNA | physical | 19322201, (Europe PMC) | NA | BioGRID |
| ELMSAN1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FANCC | Affinity Capture-Western | physical | 12397061, 15299030, (Europe PMC) | NA | BioGRID |
| FARSA | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FARSB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FTSJ3 | Affinity Capture-MS, Reconstituted Complex | physical | 21903422, (Europe PMC) | NA | BioGRID |
| FTSJ3 | anti tag coimmunoprecipitation | association, physical association | 21903422, (Europe PMC) | 0.50 | IntAct |
| GABARAPL2 | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GNL3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GPX7 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| GTPBP4 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HDGF | Affinity Capture-MS | physical | 21907836, (Europe PMC) | NA | BioGRID |
| HECW2 | Affinity Capture-MS | physical | 24163370, (Europe PMC) | NA | BioGRID |
| HIST1H1C | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HIST1H2AB | Biochemical Activity | physical | 20484669, (Europe PMC) | NA | BioGRID |
| HIST2H2AC | Biochemical Activity | physical | 9447982, (Europe PMC) | NA | BioGRID |
| HNRNPC | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HNRNPCL1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HSP90AA1 | Affinity Capture-Luminescence, Affinity Capture-Western | physical | 11447118, 22939624, (Europe PMC) | NA | BioGRID |
| HSP90AB1 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| IFI16 | Affinity Capture-MS | physical | 25693804, (Europe PMC) | NA | BioGRID |
| IFRD1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IGF2BP2 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IGF2BP3 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IKBKB | Affinity Capture-Western | physical | 10848580, (Europe PMC) | NA | BioGRID |
| IL7R | Protein-RNA | physical | 23151878, (Europe PMC) | NA | BioGRID |
| ILF2 | Biochemical Activity | physical | 11438540, (Europe PMC) | NA | BioGRID |
| ILF3 | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid | physical | 10320367, 10400669, 11438536, 11438540, (Europe PMC) | NA | BioGRID |
| IQCF1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ISG15 | Affinity Capture-MS | physical | 16009940, (Europe PMC) | NA | BioGRID |
| JAK1 | Affinity Capture-Western | physical | 17290288, (Europe PMC) | NA | BioGRID |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| KCTD17 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LMNA | Affinity Capture-MS | physical | 12882984, (Europe PMC) | NA | BioGRID |
| LYAR | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MACROD1 | Affinity Capture-MS | physical | 25735744, (Europe PMC) | NA | BioGRID |
| MAP3K5 | Affinity Capture-Western | physical | 12473108, (Europe PMC) | NA | BioGRID |
| MAP3K7 | Affinity Capture-Western | physical | 12609980, (Europe PMC) | NA | BioGRID |
| MAVS | Affinity Capture-Western | physical | 22022264, (Europe PMC) | NA | BioGRID |
| MCM2 | Affinity Capture-MS | physical | 25963833, (Europe PMC) | NA | BioGRID |
| MECP2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| METAP2 | Affinity Capture-Western, Reconstituted Complex | physical | 11123929, (Europe PMC) | NA | BioGRID |
| MIR1-1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR1-2 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR106A | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR106B | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR107 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR10B | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR122 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR128-1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR128-2 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR138-1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR138-2 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR140 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR141 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR143 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR145 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR155 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR15A | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR15B | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR16-1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR16-2 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR17 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR18A | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR18B | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR199A1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR199A2 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR19A | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR19B1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR19B2 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR200A | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR200B | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR200C | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR205 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR206 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR20A | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR20B | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR21 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR214 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR221 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR222 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR25 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR29A | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR29B1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR29B2 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR29C | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR31 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR34A | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR34B | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR34C | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR363 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR429 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR451A | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR7-1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR7-2 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR7-3 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR9-1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR9-2 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR9-3 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR92A1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR92A2 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR93 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR98 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7A1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7A2 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7A3 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7B | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7C | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7D | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7E | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7F1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7F2 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7G | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7I | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MOV10 | Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical, physical association | 21903422, (Europe PMC) | 0.50 | BioGRID, IntAct |
| NLRC4 | anti tag coimmunoprecipitation | physical association | 22801494, (Europe PMC) | 0.40 | IntAct |
| NLRP1 | anti tag coimmunoprecipitation | physical association | 22801494, (Europe PMC) | 0.40 | IntAct |
| NLRP3 | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | direct interaction, physical association | 22801494, (Europe PMC) | 0.60 | IntAct |
| NOC3L | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NOP2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NOP53 | Affinity Capture-MS | physical | 21903422, (Europe PMC) | NA | BioGRID |
| NOP53 | anti tag coimmunoprecipitation | association | 21903422, (Europe PMC) | 0.35 | IntAct |
| NPM1 | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, imaging technique | colocalization, physical, physical association | 12882984, 16957780, (Europe PMC) | 0.46 | BioGRID, IntAct, MINT |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| PABPC4 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PDGFRB | Affinity Capture-Western | physical | 11350938, (Europe PMC) | NA | BioGRID |
| PPP1CA | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex | physical | 12138106, (Europe PMC) | NA | BioGRID |
| PPP1CC | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PPP2R5A | Affinity Capture-Western | physical | 10866685, (Europe PMC) | NA | BioGRID |
| PRKRA | Affinity Capture-MS, Affinity Capture-Western, Phenotypic Enhancement, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, nuclear magnetic resonance, pull down, tandem affinity purification, two hybrid array, two hybrid prey pooling approach | association, direct interaction, genetic, physical, physical association | 11985496, 16785445, 21903422, 23455922, 24778252, 9687506, (Europe PMC) | 0.54, 0.71 | BioGRID, IntAct |
| PRKRIP1 | Affinity Capture-Western | physical | 12679338, (Europe PMC) | NA | BioGRID |
| PTEN | Affinity Capture-Western | physical | 20029030, (Europe PMC) | NA | BioGRID |
| PTGES3 | Affinity Capture-Western | physical | 11447118, (Europe PMC) | NA | BioGRID |
| PURA | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPL10 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| RPL10 | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| RPL6 | Affinity Capture-MS | physical | 12882984, (Europe PMC) | NA | BioGRID |
| RPLP0 | Affinity Capture-MS | physical | 12882984, (Europe PMC) | NA | BioGRID |
| RPS2 | Affinity Capture-MS | physical | 12882984, (Europe PMC) | NA | BioGRID |
| RPS3A | Affinity Capture-MS | physical | 12882984, (Europe PMC) | NA | BioGRID |
| SCARB2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SSB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STAT1 | Affinity Capture-Western, Reconstituted Complex | physical | 11278865, 9135145, (Europe PMC) | NA | BioGRID |
| STAT3 | Affinity Capture-Western | physical | 11350938, (Europe PMC) | NA | BioGRID |
| STAU1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STAU2 | Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical, physical association | 21903422, 24778252, (Europe PMC) | 0.50 | BioGRID, IntAct |
| TARBP2 | Affinity Capture-MS, Far Western, Reconstituted Complex, Two-hybrid | physical | 11438532, 21903422, 7568151, (Europe PMC) | NA | BioGRID |
| TARBP2 | anti tag coimmunoprecipitation | association, physical association | 21903422, (Europe PMC) | 0.50 | IntAct |
| THAP12 | Affinity Capture-Western | physical | 20484669, (Europe PMC) | NA | BioGRID |
| TOLLIP | Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical, physical association | 21903422, (Europe PMC) | 0.50 | BioGRID, IntAct |
| TOP1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TP53 | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex | physical | 10348343, 19631745, (Europe PMC) | NA | BioGRID |
| TRAF2 | Affinity Capture-Western | physical | 15121867, 25715336, (Europe PMC) | NA | BioGRID |
| TRAF5 | Affinity Capture-Western | physical | 15121867, (Europe PMC) | NA | BioGRID |
| TRAF6 | Affinity Capture-Western | physical | 15121867, 25715336, (Europe PMC) | NA | BioGRID |
| TYK2 | Affinity Capture-Western, Reconstituted Complex | physical | 17290288, (Europe PMC) | NA | BioGRID |
| XRN2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ZNF346 | Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical, physical association | 21903422, (Europe PMC) | 0.50 | BioGRID, IntAct |