DEPOD - human DEPhOsphorylation Database

Basic Information
Phosphatases
Pathway
Interacting Proteins
Phosphorylating Kinases

Gene Name	DNM2 (QuickGO)	Interactive visualization of DNM2 structures (A quick tutorial to explore the interctive visulaization) Representative structure: 2YS1
Synonyms	DNM2, DYN2
Protein Name	DNM2
Alternative Name(s)	Dynamin-2;3.6.5.5;
Protein Family	Belongs to the TRAFAC class dynamin-like GTPasesuperfamily Dynamin/Fzo/YdjA family
EntrezGene ID	1785 (Comparitive Toxicogenomics)
UniProt AC (Human)	P50570 (protein sequence)
Enzyme Class	3.6.5.5 (BRENDA )
Molecular Weight	98064 Dalton
Protein Length	870 amino acids (AA)
Genome Browsers	NCBI \| ENSG00000079805 (Ensembl) \| UCSC
Crosslinking annotations	Query our ID-mapping table
Orthologues	Quest For Orthologues (QFO) \| GeneTree \| eggNOG - KOG0446 \| eggNOG - COG0699
Phosphorylation Network	Visualize

Domain organization, Expression, Diseases

(show / hide)

Localization, Function, Catalytic activity and Sequence

(show / hide)

Localization (UniProt annotation)
Cytoplasm Cytoplasm, cytoskeleton Celljunction Membrane, clathrin-coatedpit Cell junction, synapse,postsynaptic cell membrane, postsynaptic density Cell junction,synapse Midbody Cell projection, phagocytic cup Cytoplasmic vesicle, phagosomemembrane Note=Colocalizes with CTTNat the basis of filopodia in hippocampus neuron growth zones (Bysimilarity) Microtubule-associated Also found in thepostsynaptic density of neuronal cells Co-localizes with PIK3C3and RAB5A to the nascent phagosome (By similarity)
Function (UniProt annotation)
Microtubule-associated force-producing protein involvedin producing microtubule bundles and able to bind and hydrolyzeGTP Plays a role in the regulation of neuron morphology, axongrowth and formation of neuronal growth cones (By similarity)Plays an important role in vesicular trafficking processes, inparticular endocytosis Involved in cytokinesis (PubMed:12498685)Regulates maturation of apoptotic cell corpse-containingphagosomes by recruiting PIK3C3 to the phagosome membrane (Bysimilarity)
Catalytic Activity (UniProt annotation)
GTP + H(2)O = GDP + phosphate
Protein Sequence
MGNRGMEELIPLVNKLQDAFSSIGQSCHLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLIFSKTEH AEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIKDMI LQFISRESSLILAVTPANMDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQK DIEGKKDIRAALAAERKFFLSHPAYRHMADRMGTPHLQKTLNQQLTNHIRESLPALRSKLQSQLLSLEKEVEEYKNFRPD DPTRKTKALLQMVQQFGVDFEKRIEGSGDQVDTLELSGGARINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGVRT GLFTPDLAFEAIVKKQVVKLKEPCLKCVDLVIQELINTVRQCTSKLSSYPRLREETERIVTTYIREREGRTKDQILLLID IEQSYINTNHEDFIGFANAQQRSTQLNKKRAIPNQGEILVIRRGWLTINNISLMKGGSKEYWFVLTAESLSWYKDEEEKE KKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRNVYKDLRQIELACDSQEDVDSWKASFLRAGVYPEKDQAENEDGAQE NTFSMDPQLERQVETIRNLVDSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLYSSADQSSLMEESADQAQRRD DMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWLQSASSHSPTPQRRPVSSIHPPGRPPAVRGPTPGPPLIPVPVGA AASFSAPPIPSRPGPQSVFANSDLFPAPPQIPSRPVRIPPGIPPGVPSRRPPAAPSRPTIIRPAEPSLLD

Motif information from Eukaryotic Linear Motif atlas (ELM)

(show / hide)

Gene Ontology (P: Process; F: Function and C: Component terms)

(show / hide)

GO:0000086	P:G2/M transition of mitotic cell cycle
GO:0000139	C:Golgi membrane
GO:0000266	P:mitochondrial fission
GO:0001891	C:phagocytic cup
GO:0001917	C:photoreceptor inner segment
GO:0002031	P:G-protein coupled receptor internalization
GO:0003281	P:ventricular septum development
GO:0003374	P:dynamin family protein polymerization involved in mitochondrial fission
GO:0003924	F:GTPase activity
GO:0005525	F:GTP binding
GO:0005634	C:nucleus
GO:0005768	C:endosome
GO:0005794	C:Golgi apparatus
GO:0005802	C:trans-Golgi network
GO:0005813	C:centrosome
GO:0005829	C:cytosol
GO:0005874	C:microtubule
GO:0005886	C:plasma membrane
GO:0005905	C:clathrin-coated pit
GO:0005925	C:focal adhesion
GO:0006355	P:regulation of transcription
GO:0006893	DNA-templated
GO:0006897	P:Golgi to plasma membrane transport
GO:0006898	P:endocytosis
GO:0006909	P:receptor-mediated endocytosis
GO:0007165	P:phagocytosis
GO:0007283	P:signal transduction
GO:0008017	P:spermatogenesis
GO:0009416	F:microtubule binding
GO:0010592	P:response to light stimulus
GO:0017124	P:positive regulation of lamellipodium assembly
GO:0019886	F:SH3 domain binding
GO:0019899	P:antigen processing and presentation of exogenous peptide antigen via MHC class II
GO:0019901	F:enzyme binding
GO:0030027	F:protein kinase binding
GO:0030426	C:lamellipodium
GO:0030496	C:growth cone
GO:0030512	C:midbody
GO:0030516	P:negative regulation of transforming growth factor beta receptor signaling pathway
GO:0030666	P:regulation of axon extension
GO:0030670	C:endocytic vesicle membrane
GO:0031623	C:phagocytic vesicle membrane
GO:0031749	P:receptor internalization
GO:0031966	F:D2 dopamine receptor binding
GO:0032587	C:mitochondrial membrane
GO:0032991	C:ruffle membrane
GO:0033572	C:protein-containing complex
GO:0035020	P:transferrin transport
GO:0035904	P:regulation of Rac protein signal transduction
GO:0036312	P:aorta development
GO:0042220	F:phosphatidylinositol 3-kinase regulatory subunit binding
GO:0043065	P:response to cocaine
GO:0044351	P:positive regulation of apoptotic process
GO:0044877	P:macropinocytosis
GO:0045211	F:protein-containing complex binding
GO:0045334	C:postsynaptic membrane
GO:0045429	C:clathrin-coated endocytic vesicle
GO:0045893	P:positive regulation of nitric oxide biosynthetic process
GO:0048471	P:positive regulation of transcription
GO:0048488	DNA-templated
GO:0048489	C:perinuclear region of cytoplasm
GO:0048812	P:synaptic vesicle endocytosis
GO:0050699	P:synaptic vesicle transport
GO:0050766	P:neuron projection morphogenesis
GO:0050998	F:WW domain binding
GO:0050999	P:positive regulation of phagocytosis
GO:0060976	F:nitric-oxide synthase binding
GO:0061024	P:regulation of nitric-oxide synthase activity
GO:0061025	P:coronary vasculature development
GO:0070062	P:membrane organization
GO:0071245	P:membrane fusion
GO:0071481	C:extracellular exosome
GO:0071732	P:cellular response to carbon monoxide
GO:0098793	P:cellular response to X-ray
GO:0098978	P:cellular response to nitric oxide
GO:0099092	C:presynapse
GO:1900026	C:glutamatergic synapse
GO:1902856	C:postsynaptic density
GO:1903351	intracellular component
GO:1903358	P:positive regulation of substrate adhesion-dependent cell spreading
GO:1903408	P:negative regulation of non-motile cilium assembly
GO:1903526	P:cellular response to dopamine
GO:2000370	P:regulation of Golgi organization

KEGG Pathway
Reactome Pathway

Pathway ID	Pathway Name	Pathway Description (KEGG)
hsa04072	Phospholipase D signaling pathway	Phospholipase D (PLD) is an essential enzyme responsible for the production of the lipid second messenger phosphatidic acid (PA), which is involved in fundamental cellular processes, including membrane trafficking, actin cytoskeleton remodeling, cell proliferation and cell survival. PLD activity can be stimulated by a large number of cell surface receptors and is elaborately regulated by intracellular factors, including protein kinase C isoforms, small GTPases of the ARF, Rho and Ras families and the phosphoinositide, phosphatidylinositol 4,5-bisphosphate (PIP2). The PLD-produced PA activates signaling proteins and acts as a node within the membrane to which signaling proteins translocate. Several signaling proteins, including Raf-1 and mTOR, directly bind PA to mediate translocation or activation, respectively.
hsa04144	Endocytosis	Endocytosis is a mechanism for cells to remove ligands, nutrients, and plasma membrane (PM) proteins, and lipids from the cell surface, bringing them into the cell interior. Transmembrane proteins entering through clathrin-dependent endocytosis (CDE) have sequences in their cytoplasmic domains that bind to the APs (adaptor-related protein complexes) and enable their rapid removal from the PM. In addition to APs and clathrin, there are numerous accessory proteins including dynamin. Depending on the various proteins that enter the endosome membrane, these cargoes are sorted to distinct destinations. Some cargoes, such as nutrient receptors, are recycled back to the PM. Ubiquitylated membrane proteins, such as activated growth-factor receptors, are sorted into intraluminal vesicles and eventually end up in the lysosome lumen via multivesicular endosomes (MVEs). There are distinct mechanisms of clathrin-independent endocytosis (CIE) depending upon the cargo and the cell type.
hsa04666	Fc gamma R-mediated phagocytosis	Phagocytosis plays an essential role in host-defense mechanisms through the uptake and destruction of infectious pathogens. Specialized cell types including macrophages, neutrophils, and monocytes take part in this process in higher organisms. After opsonization with antibodies (IgG), foreign extracellular materials are recognized by Fc gamma receptors. Cross-linking of Fc gamma receptors initiates a variety of signals mediated by tyrosine phosphorylation of multiple proteins, which lead through the actin cytoskeleton rearrangements and membrane remodeling to the formation of phagosomes. Nascent phagosomes undergo a process of maturation that involves fusion with lysosomes. The acquisition of lysosomal proteases and release of reactive oxygen species are crucial for digestion of engulfed materials in phagosomes.
hsa04721	Synaptic vesicle cycle	Communication between neurons is mediated by the release of neurotransmitter from synaptic vesicles (SVs). At the nerve terminal, SVs cycle through repetitive episodes of exocytosis and endocytosis. SVs are filled with neurotransmitters by active transport. The loaded SVs are then docked at a specialized region of the presynaptic plasma membrane known as the active zone, where they undergo a priming reaction. Upon arrival of an action potential, Ca2+ enters through voltage-gated channels and neurotransmitter is released by exocytosis, usually in less than a millisecond. After fusion, the vesicle is retrieved by endocytosis and reloaded for another round of exocytosis.
hsa04961	Endocrine and other factor-regulated calcium reabsorption	Calcium (Ca2+) is essential for numerous physiological functions including intracellular signalling processes, neuronal excitability, muscle contraction and bone formation. Therefore, its homeostasis is finely maintained through the coordination of intestinal absorption, renal reabsorption, and bone resorption. In kidney, the late part of the distal convoluted tubule (DCT) and the connecting tubule (CNT) are the site of active Ca2+ transport and precisely regulate Ca2+ reabsorption. Following Ca2+ entry through TRPV5, Ca2+ bound to calbindin-D28K diffuses to the basolateral side, where it is extruded into the blood compartment through NCX1 and to a lesser extent PMCA1b. In the urinary compartment, both klotho and tissue kallikrein (TK) increase the apical abundance of TRPV5. In the blood compartment, PTH, 1,25(OH)2D3 and estrogen increase the transcription and protein expression of the luminal Ca2+ channels, calbindins, and the extrusion systems.
hsa05100	Bacterial invasion of epithelial cells	Many pathogenic bacteria can invade phagocytic and non-phagocytic cells and colonize them intracellularly, then become disseminated to other cells. Invasive bacteria induce their own uptake by non-phagocytic host cells (e.g. epithelial cells) using two mechanisms referred to as zipper model and trigger model. Listeria, Staphylococcus, Streptococcus, and Yersinia are examples of bacteria that enter using the zipper model. These bacteria express proteins on their surfaces that interact with cellular receptors, initiating signalling cascades that result in close apposition of the cellular membrane around the entering bacteria. Shigella and Salmonella are the examples of bacteria entering cells using the trigger model. These bacteria use type III secretion systems to inject protein effectors that interact with the actin cytoskeleton.

Pathway ID	Pathway Name	Pathway Description (KEGG)
R-HSA-166016	Toll Like Receptor 4 (TLR4) Cascade.	TLR4 is unique among the TLR family in its ability to recruit four adapters to activate two distinct signaling pathways. One pathway is activated by the pair of the adapters Mal or TIRAP (Toll/interleukin-1-receptor (TIR)-domain-containing adapter protein) and MyD88, which leads to the NFkB activation and the induction of pro-inflammatory cytokines. The second pathway is activated by the adapters TRIF (TIR-domain-containing adapter protein inducing interferon-beta) and TRAM (TRIF-related adapter molecule). The combined use of TRIF and TRAM adapters is specific for TLR4 signaling pathway and leads to the induction of type I interferons and delayed activation of NFkB. The previous model of TLR4 signaling pathway described the simultaneous activation of these two signaling pathways at the plasma membrane, however the later studies suggested that upon activation TLR4 first induces TIRAP-MyD88 signaling at the plasma membrane and is then endocytosed and activates TRAM-TRIF signaling from the early endosome [Kagan JC et al 2008; Tanimura N et al 2008; Zanoni I et al 2011]
R-HSA-177504	Retrograde neurotrophin signalling.	Neurotrophin-TRK complexes can be internalized and enter signalling vesicles, which travel retrogradely over long distances from distal nerve terminals to neuronal cell bodies. Such retrograde signalling by neurotrophin-TRK complexes regulates survival, synaptogenesis and maintenance of proper neural connectivity. The neurotrophin-TRK complex may use three distinct internalization pathways. Although Clathrin-mediated endocytosys appears to be the major internalization route, it is controversial whether it also represents the dominant pathway for retrograde transport and signalling. Pyncher-mediated endocytosis might be more relevant in this regard. Moreover, also caveolin-mediated endocytosis may play a role in NGF-TrkA internalization.Retrograde transport of TRKs is microtubule-dependent: TRKs remain activated and bound to neurotrophins during retrograde transport. The current view is reflected in the signalling endosome model. It is a specialized vesicle containing ligand (NGF, BDNF) bound to its activated TRK receptor, together with activated downstream signalling proteins, transported by motor proteins (dyneins) from nerve terminals to remote cell bodies, where the receptors trigger signalling cascades
R-HSA-190873	Gap junction degradation.	The half-life of Cx is very short (1 to 5h) compared to other junctional proteins (Laird et al., 1995 ; Fallon and Goudenough, 1981). Connexins are targeted for degradation by the proteasome and the lysosome. Degradation appears to involve the phosphorylation of Connexins as well as their interactions with other proteins (Piehl et al., 2007)
R-HSA-196025	Formation of annular gap junctions.	Until now, two kinds of annular gap junctions have been described. The first is a small vesicle like structure which permits gap junction plaque renewal without arrest of functionality [Jordan et al., 2001]. The second is a large annular structure, composed primarily of the junctional plaques of two adjacent cells (Jordan et al., 2001; Segretain et al., 2004)
R-HSA-203641	NOSTRIN mediated eNOS trafficking.	eNOS traffic inducer (NOSTRIN) is a novel 506-amino acid eNOS-interacting protein. Along with a decrease in eNOS activity, NOSTRIN causes translocation of eNOS from the plasma membrane to intracellular vesicular structures. NOSTRIN functions as an adaptor protein through homotrimerization and recruitment of eNOS, dynamin-2, and N-WASP to its SH3 domain. Studies indicated that NOSTRIN may facilitate vesicle fission and endocytosis of eNOS by coordinating the function of dynamin and N-WASP, which in turn, recruits the Arp2/3 complex, initiating actin filament polymerization. Overall, this process is thought to occur via caveolar endocytosis
R-HSA-2132295	MHC class II antigen presentation.	Antigen presenting cells (APCs) such as B cells, dendritic cells (DCs) and monocytes/macrophages express major histocompatibility complex class II molecules (MHC II) at their surface and present exogenous antigenic peptides to CD4+ T helper cells. CD4+ T cells play a central role in immune protection. On their activation they stimulate differentiation of B cells into antibody-producing B-cell blasts and initiate adaptive immune responses. MHC class II molecules are transmembrane glycoprotein heterodimers of alpha and beta subunits. Newly synthesized MHC II molecules present in the endoplasmic reticulum bind to a chaperone protein called invariant (Ii) chain. The binding of Ii prevents the premature binding of self antigens to the nascent MHC molecules in the ER and also guides MHC molecules to endocytic compartments. In the acidic endosomal environment, Ii is degraded in a stepwise manner, ultimately to free the class II peptide-binding groove for loading of antigenic peptides. Exogenous antigens are internalized by the APC by receptor mediated endocytosis, phagocytosis or pinocytosis into endocytic compartments of MHC class II positive cells, where engulfed antigens are degraded in a low pH environment by multiple acidic proteases, generating MHC class II epitopes. Antigenic peptides are then loaded into the class II ligand-binding groove. The resulting class II peptide complexes then move to the cell surface, where they are scanned by CD4+ T cells for specific recognition (Berger & Roche 2009, Zhou & Blum 2004, Watts 2004, Landsverk et al. 2009)
R-HSA-432720	Lysosome Vesicle Biogenesis.	Proteins that have been synthesized, processed and sorted eventually reach the final steps of the secretory pathway. This pathway is responsible not only for proteins that are secreted from the cell but also enzymes and other resident proteins in the lumen of the ER, Golgi, and lysosomes as well as integral proteins transported in the vesicle membranes. Here the proteins in this secretory pathway are ultimately found in lysososmes
R-HSA-432722	Golgi Associated Vesicle Biogenesis.	Proteins that have been synthesized, processed and sorted eventually reach the final steps of the secretory pathway. This pathway is responsible not only for proteins that are secreted from the cell but also enzymes and other resident proteins in the lumen of the ER, Golgi, and lysosomes as well as integral proteins transported in the vesicle membranes
R-HSA-437239	Recycling pathway of L1.	L1 functions in many aspects of neuronal development including axon outgrowth and neuronal migration. These functions require coordination between L1 and the actin cytoskeleton. F-actin continuously moves in a retrograde direction from the P-(peripheral) domain of the growth cone towards the growth cone's C-(central) domain. L1, attached to the actin cytoskeleton via membrane cytoskeletal linkers (MCKs) such as ankyrins (Ankyrin-G, -B and -R) and members of the ERMs (ezrin, radixin, and moesin) family, link this retrograde F-actin flow with extracellular immobile ligands.Forward translocation of growth cone requires not only the CAM-actin linkage but also a gradient of cell substrate adhesion (strong adhesion at the front and weak adhesion at the rear) so that the cytoskeletal machinery is able to pull the cell forward as attachments at the rear are released. This asymmetry is achieved in part by internalizing L1 molecules as they are moved to the rear of the growth cone coupled to retrograde F-actin flow and recycling them to the leading edge plasma membrane.L1 internalization is mediated by phosphorylation and dephosphorylation. The L1 cytoplasmic domain (L1CD) carries an endocytic or sorting motif, YRSLE, that is recognized by the clathrin associated adaptor protein-2 (AP-2). AP-2 binds the YRSLE motif only when its tyrosine is not phosphorylated and triggers L1 endocytosis. SRC kinase associated with lipid rafts in the P-domain membrane phosphorylates L1 molecules on tyrosine-1176, stabilizing them in the plasma membrane. L1 endocytosis is triggered by the dephosphorylation of Y1176 within the C domain. Some of these internalized L1 molecules are transported in an anterograde direction along microtubules for reuse in the leading edge
R-HSA-8856828	Clathrin-mediated endocytosis.	Clathrin-mediated endocytosis (CME) is one of a number of process that control the uptake of material from the plasma membrane, and leads to the formation of clathrin-coated vesicles (Pearse et al, 1975; reviewed in Robinson, 2015; McMahon and Boucrot, 2011; Kirchhausen et al, 2014). CME contributes to signal transduction by regulating the cell surface expression and signaling of receptor tyrosine kinases (RTKs) and G-protein coupled receptors (GPCRs). Most RTKs exhibit a robust increase in internalization rate after binding specific ligands; however, some RTKs may also exhibit significant ligand-independent internalization (reviewed in Goh and Sorkin, 2013). CME controls RTK and GPCR signaling by organizing signaling both within the plasma membrane and on endosomes (reviewed in Eichel et al, 2016; Garay et al, 2015; Vieira et al, 1996; Sorkin and von Zastrow, 2014; Di Fiori and von Zastrow, 2014; Barbieri et al, 2016). CME also contributes to the uptake of material such as metabolites, hormones and other proteins from the extracellular space, and regulates membrane composition by recycling membrane components and/or targeting them for degradation. Clathrin-mediated endocytosis involves initiation of clathrin-coated pit (CCP) formation, cargo selection, coat assembly and stabilization, membrane scission and vesicle uncoating. Although for simplicity in this pathway, the steps leading to a mature CCP are represented in a linear and temporally distinct fashion, the formation of a clathrin-coated vesicle is a highly heterogeneous process and clear temporal boundaries between these processes may not exist (see for instance Taylor et al, 2011; Antonescu et al, 2011; reviewed in Kirchhausen et al, 2014). Cargo selection in particular is a critical aspect of the formation of a mature and stable CCP, and many of the proteins involved in the initiation and maturation of a CCP contribute to cargo selection and are themselves stabilized upon incorporation of cargo into the nascent vesicle (reviewed in Kirchhausen et al, 2014; McMahon and Boucrot, 2011).Although the clathrin triskelion was identified early as a major component of the coated vesicles, clathrin does not bind directly to membranes or to the endocytosed cargo. Vesicle formation instead relies on many proteins and adaptors that can bind the plasma membrane and interact with cargo molecules. Cargo selection depends on the recognition of endocytic signals in cytoplasmic tails of the cargo proteins by adaptors that interact with components of the vesicle's inner coat. The classic adaptor for clathrin-coated vesicles is the tetrameric AP-2 complex, which along with clathrin was identified early as a major component of the coat. Some cargo indeed bind directly to AP-2, but subsequent work has revealed a large family of proteins collectively known as CLASPs (clathrin- associated sorting proteins) that mediate the recruitment of diverse cargo into the emerging clathrin-coated vesicles (reviewed in Traub and Bonifacino, 2013). Many of these CLASP proteins themselves interact with AP-2 and clathrin, coordinating cargo recruitment with coat formation (Schmid et al, 2006; Edeling et al, 2006; reviewed in Traub and Bonifacino, 2013; Kirchhausen et al, 2014). Initiation of CCP formation is also influenced by lipid composition, regulated by clathrin-associated phosphatases and kinases (reviewed in Picas et al, 2016). The plasma membrane is enriched in PI(4,5)P2. Many of the proteins involved in initiating clathrin-coated pit formation bind to PI(4,5)P2 and induce membrane curvature through their BAR domains (reviewed in McMahon and Boucrot, 2011; Daumke et al, 2014). Epsin also contributes to early membrane curvature through its Epsin N-terminal homology (ENTH) domain, which promotes membrane curvature by inserting into the lipid bilayer (Ford et al, 2002). Following initiation, some CCPs progress to formation of vesicles, while others undergo disassembly at the cell surface without producing vesicles (Ehrlich et al, 2004; Loerke et al, 2009; Loerke et al, 2011; Aguet et al, 2013; Taylor et al, 2011). The assembly and stabilization of nascent CCPs is regulated by several proteins and lipids (Mettlen et al, 2009; Antonescu et al, 2011).Maturation of the emerging clathrin-coated vesicle is accompanied by further changes in the lipid composition of the membrane and increased membrane curvature, promoted by the recruitment of N-BAR domain containing proteins (reviewed in Daumke et al, 2014; Ferguson and De Camilli, 2012; Picas et al, 2016). Some N-BAR domain containing proteins also contribute to the recruitment of the large GTPase dynamin, which is responsible for scission of the mature vesicle from the plasma membrane (Koh et al, 2007; Lundmark and Carlsson, 2003; Soulet et al, 2005; David et al, 1996; Owen et al, 1998; Shupliakov et al, 1997; Taylor et al, 2011; Ferguson et al, 2009; Aguet et al, 2013; Posor et al, 2013; Chappie et al, 2010; Shnyrova et al, 2013; reviewed in Mettlen et al, 2009; Daumke et al, 2014). After vesicle scission, the clathrin coat is dissociated from the new vesicle by the ATPase HSPA8 (also known as HSC70) and its DNAJ cofactor auxilin, priming the vesicle for fusion with a subsequent endocytic compartment and releasing clathrin for reuse (reviewed in McMahon and Boucrot, 2011; Sousa and Laufer, 2015)

BioGRID
IntAct
MINT
ALL

Visualize Download

Interacting partner	Detection method	Interaction type	PubMed IDs	Interaction Score	Source
AMPH	Reconstituted Complex, peptide array, surface plasmon resonance	association, direct interaction, physical	10542231, 15834155, 16696976, (Europe PMC)	0.71	BioGRID, IntAct, MINT
APP	Reconstituted Complex	physical	21244100, 21832049, (Europe PMC)	NA	BioGRID
ATXN3	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
BIN1	Protein-peptide	physical	25350771, (Europe PMC)	NA	BioGRID
BUB3	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	26496610, (Europe PMC)	0.35	BioGRID, IntAct
CCDC90B	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
CCT7	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
CD2AP	Affinity Capture-Western	physical	12672817, (Europe PMC)	NA	BioGRID
CDC5L	Affinity Capture-MS, anti bait coimmunoprecipitation	association, physical	20467437, (Europe PMC)	0.35	BioGRID, IntAct, MINT
CFTR	Affinity Capture-MS	physical	26618866, (Europe PMC)	NA	BioGRID
CNTRL	Proximity Label-MS, proximity-dependent biotin identification	association, physical	26638075, (Europe PMC)	0.35	BioGRID, IntAct
CTTN	Affinity Capture-Western, dynamic light scattering, molecular sieving, nuclear magnetic resonance, pull down	direct interaction, physical, physical association	16636290, (Europe PMC)	0.65	BioGRID, IntAct, MINT
DCTN1	Proximity Label-MS, proximity-dependent biotin identification	association, physical	26638075, (Europe PMC)	0.35	BioGRID, IntAct
DDX39B	Two-hybrid, two hybrid pooling approach	physical, physical association	16169070, (Europe PMC)	0.37	BioGRID, IntAct
DNALI1	Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification	association, physical, physical association	27173435, (Europe PMC)	0.51	BioGRID, IntAct
DNM1	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
DNM3	Affinity Capture-MS	physical	26186194, 28514442, (Europe PMC)	NA	BioGRID
DYNC1I1	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
EGFR	Affinity Capture-MS	physical	24797263, (Europe PMC)	NA	BioGRID
EPS15	Affinity Capture-Western	physical	11483962, (Europe PMC)	NA	BioGRID
FBF1	Proximity Label-MS, proximity-dependent biotin identification	association, physical	26638075, (Europe PMC)	0.35	BioGRID, IntAct
FBXO6	Affinity Capture-MS	physical	22268729, (Europe PMC)	NA	BioGRID
FCHSD1	Affinity Capture-MS	physical	19041431, (Europe PMC)	NA	BioGRID
FER	Co-fractionation	physical	9722593, (Europe PMC)	NA	BioGRID
FGFR1OP	Proximity Label-MS, proximity-dependent biotin identification	association, physical	26638075, (Europe PMC)	0.35	BioGRID, IntAct
FN1	Affinity Capture-MS	physical	19738201, (Europe PMC)	NA	BioGRID
FNBP1	Co-localization, Reconstituted Complex, fluorescence technology, pull down	colocalization, physical, physical association	15252009, 16418535, (Europe PMC)	0.50	BioGRID, IntAct
FNBP1L	Reconstituted Complex	physical	16418535, (Europe PMC)	NA	BioGRID
GBE1	Co-fractionation	physical	26344197, (Europe PMC)	NA	BioGRID
GDF9	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
GGA1	Co-fractionation	physical	26344197, (Europe PMC)	NA	BioGRID
GRB2	Affinity Capture-MS, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, barcode fusion genetics two hybrid, surface plasmon resonance, tandem affinity purification, two hybrid, validated two hybrid	association, direct interaction, physical, physical association	15834155, 16696976, 19380743, 21706016, 21988832, 27107012, 28514442, (Europe PMC)	0.89	BioGRID, IntAct, MINT
GTF2E2	Affinity Capture-MS	physical	17643375, (Europe PMC)	NA	BioGRID
GYPB	Affinity Capture-MS	physical	28514442, (Europe PMC)	NA	BioGRID
HMGB1	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
HNRNPD	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	26496610, (Europe PMC)	0.35	BioGRID, IntAct
HTR6	Affinity Capture-MS	physical	23027611, (Europe PMC)	NA	BioGRID
ITGA4	Affinity Capture-MS	physical	22623428, (Europe PMC)	NA	BioGRID
ITSN1	Reconstituted Complex, Two-hybrid, surface plasmon resonance, two hybrid	direct interaction, physical, physical association	15834155, 16696976, 21900206, (Europe PMC)	0.71	BioGRID, IntAct, MINT
ITSN2	Two-hybrid	physical	22558309, (Europe PMC)	NA	BioGRID
KCNN3	Affinity Capture-Western	physical	22952906, (Europe PMC)	NA	BioGRID
KDR	Affinity Capture-Western	physical	16049137, (Europe PMC)	NA	BioGRID
LYPD6	Affinity Capture-MS	physical	26186194, 28514442, (Europe PMC)	NA	BioGRID
MAN1B1	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
MANEA	Reconstituted Complex	physical	16696976, (Europe PMC)	NA	BioGRID
MEPCE	Affinity Capture-MS	physical	17643375, (Europe PMC)	NA	BioGRID
MPP6	Two-hybrid	physical	15231747, (Europe PMC)	NA	BioGRID
NPHP1	Proximity Label-MS, proximity-dependent biotin identification	association, physical	26638075, (Europe PMC)	0.35	BioGRID, IntAct
NTRK1	Affinity Capture-MS	physical	25921289, (Europe PMC)	NA	BioGRID
OFD1	Proximity Label-MS, proximity-dependent biotin identification	association, physical	26638075, (Europe PMC)	0.35	BioGRID, IntAct
PACSIN1	Affinity Capture-MS	physical	19041431, (Europe PMC)	NA	BioGRID
PACSIN2	Affinity Capture-MS, anti bait coimmunoprecipitation, pull down	physical, physical association	16551695, 19041431, (Europe PMC)	0.52	BioGRID, IntAct, MINT
PACSIN3	Affinity Capture-MS	physical	19041431, (Europe PMC)	NA	BioGRID
PDE6G	Reconstituted Complex	physical	12624098, (Europe PMC)	NA	BioGRID
PDGFRA	Affinity Capture-Western	physical	21996738, (Europe PMC)	NA	BioGRID
PEX14	Co-purification, pull down	association, physical	21525035, (Europe PMC)	0.35	BioGRID, IntAct
PICALM	Co-fractionation	physical	22939629, (Europe PMC)	NA	BioGRID
PIK3R1	Affinity Capture-Western	physical	21996738, (Europe PMC)	NA	BioGRID
PLK1	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	26496610, (Europe PMC)	0.35	BioGRID, IntAct
PML	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	26496610, (Europe PMC)	0.35	BioGRID, IntAct
PSTPIP1	Affinity Capture-MS, Reconstituted Complex	physical	16418535, 19041431, (Europe PMC)	NA	BioGRID
PTPN11	Affinity Capture-Western	physical	21996738, (Europe PMC)	NA	BioGRID
PTPN13	Co-fractionation	physical	26344197, (Europe PMC)	NA	BioGRID
RBM3	Affinity Capture-MS	physical	26472337, (Europe PMC)	NA	BioGRID
RBMS1	Co-fractionation	physical	22939629, (Europe PMC)	NA	BioGRID
RHOU	Reconstituted Complex	physical	26598620, (Europe PMC)	NA	BioGRID
RPAP2	Affinity Capture-MS	physical	17643375, (Europe PMC)	NA	BioGRID
RPE	Co-fractionation	physical	26344197, (Europe PMC)	NA	BioGRID
RPGR	Proximity Label-MS, proximity-dependent biotin identification	association, physical	26638075, (Europe PMC)	0.35	BioGRID, IntAct
RPS2	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
RTCB	Co-fractionation	physical	26344197, (Europe PMC)	NA	BioGRID
RUVBL2	Affinity Capture-MS	physical	17643375, (Europe PMC)	NA	BioGRID
RWDD2B	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
SCN2B	Affinity Capture-MS	physical	26186194, 28514442, (Europe PMC)	NA	BioGRID
SH3GL2	Reconstituted Complex, pull down, surface plasmon resonance	direct interaction, physical, physical association	15834155, 16696976, 17257598, (Europe PMC)	0.72	BioGRID, IntAct, MINT
SH3KBP1	Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, anti bait coimmunoprecipitation, pull down	physical, physical association	19531213, 20711168, 26344197, (Europe PMC)	0.52	BioGRID, IntAct, MINT
SHANK1	Affinity Capture-Western, Reconstituted Complex, Two-hybrid	physical	11583995, (Europe PMC)	NA	BioGRID
SHANK2	Affinity Capture-Western, Reconstituted Complex, Two-hybrid	physical	11583995, (Europe PMC)	NA	BioGRID
SHC1	Affinity Capture-MS, tandem affinity purification	association, physical	19380743, (Europe PMC)	0.35	BioGRID, IntAct
SIRT7	Affinity Capture-MS	physical	22586326, (Europe PMC)	NA	BioGRID
SLC30A5	Co-fractionation	physical	22939629, (Europe PMC)	NA	BioGRID
SNW1	Affinity Capture-MS, anti bait coimmunoprecipitation	association, physical	20467437, (Europe PMC)	0.35	BioGRID, IntAct, MINT
SNX18	Affinity Capture-Western	physical	26923255, (Europe PMC)	NA	BioGRID
SNX9	Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, barcode fusion genetics two hybrid, imaging technique, pull down, validated two hybrid	colocalization, direct interaction, physical, physical association	12952949, 15703209, 18388313, 27107012, 28514442, (Europe PMC)	0.81	BioGRID, IntAct, MINT
SPRY2	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
SRC	Reconstituted Complex, surface plasmon resonance	direct interaction, physical	15834155, (Europe PMC)	0.44	BioGRID, IntAct, MINT
STAU1	Affinity Capture-MS	physical	23125841, (Europe PMC)	NA	BioGRID
TBC1D15	Affinity Capture-MS	physical	28514442, (Europe PMC)	NA	BioGRID
TCTN1	Proximity Label-MS, proximity-dependent biotin identification	association, physical	26638075, (Europe PMC)	0.35	BioGRID, IntAct
TES	Affinity Capture-MS	physical	28378594, (Europe PMC)	NA	BioGRID
TIAM2	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
TMEM9B	Affinity Capture-MS	physical	28514442, (Europe PMC)	NA	BioGRID
TRIM25	Affinity Capture-RNA	physical	29117863, (Europe PMC)	NA	BioGRID
TRIP10	Affinity Capture-MS, Reconstituted Complex	physical	16418535, 19041431, (Europe PMC)	NA	BioGRID
TYK2	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
VCAM1	Affinity Capture-MS, cross-linking study	association, physical	19738201, 22623428, (Europe PMC)	0.35	BioGRID, IntAct
WBP4	Reconstituted Complex	physical	16055720, (Europe PMC)	NA	BioGRID
WIPI2	Affinity Capture-MS	physical	20562859, (Europe PMC)	NA	BioGRID
XRCC6	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	26496610, (Europe PMC)	0.35	BioGRID, IntAct
ZBBX	Affinity Capture-MS	physical	28514442, (Europe PMC)	NA	BioGRID
ZBTB16	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT

Visualize Download

Interacting partner	Detection method	Interaction type	PubMed IDs	Interaction Score	Source
ACTB	fluorescence microscopy	colocalization	19116150, (Europe PMC)	0.27	IntAct, MINT
AHI1	Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	association, physical, physical association	22623184, (Europe PMC)	0.50	BioGRID, IntAct
AMPH	Reconstituted Complex, peptide array, surface plasmon resonance	association, direct interaction, physical	10542231, 15834155, 16696976, (Europe PMC)	0.71	BioGRID, IntAct, MINT
APPL1	two hybrid fragment pooling approach	physical association	23414517, (Europe PMC)	0.37	IntAct
ATG9A	fluorescence microscopy	colocalization	24603492, (Europe PMC)	0.27	IntAct, MINT
ATXN3	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
BUB3	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	26496610, (Europe PMC)	0.35	BioGRID, IntAct
CCDC90B	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
CCT7	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
CDC5L	Affinity Capture-MS, anti bait coimmunoprecipitation	association, physical	20467437, (Europe PMC)	0.35	BioGRID, IntAct, MINT
CNTRL	Proximity Label-MS, proximity-dependent biotin identification	association, physical	26638075, (Europe PMC)	0.35	BioGRID, IntAct
CRK	peptide array	physical association	17474147, (Europe PMC)	0.40	IntAct
CTTN	Affinity Capture-Western, dynamic light scattering, molecular sieving, nuclear magnetic resonance, pull down	direct interaction, physical, physical association	16636290, (Europe PMC)	0.65	BioGRID, IntAct, MINT
DCTN1	Proximity Label-MS, proximity-dependent biotin identification	association, physical	26638075, (Europe PMC)	0.35	BioGRID, IntAct
DDX39B	Two-hybrid, two hybrid pooling approach	physical, physical association	16169070, (Europe PMC)	0.37	BioGRID, IntAct
DNALI1	Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification	association, physical, physical association	27173435, (Europe PMC)	0.51	BioGRID, IntAct
DNM1	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
DNM2	barcode fusion genetics two hybrid, validated two hybrid	physical association	27107012, (Europe PMC)	0.49	IntAct
DYNC1I1	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
EIF3L	two hybrid pooling approach	physical association	16169070, (Europe PMC)	0.37	IntAct
ERBB2	anti bait coimmunoprecipitation	association	16314522, (Europe PMC)	0.35	IntAct
FBF1	Proximity Label-MS, proximity-dependent biotin identification	association, physical	26638075, (Europe PMC)	0.35	BioGRID, IntAct
FGFR1OP	Proximity Label-MS, proximity-dependent biotin identification	association, physical	26638075, (Europe PMC)	0.35	BioGRID, IntAct
FNBP1	Co-localization, Reconstituted Complex, fluorescence technology, pull down	colocalization, physical, physical association	15252009, 16418535, (Europe PMC)	0.50	BioGRID, IntAct
GDF9	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
GOLGA2	barcode fusion genetics two hybrid, validated two hybrid	physical association	27107012, (Europe PMC)	0.49	IntAct
GRAP2	barcode fusion genetics two hybrid, validated two hybrid	physical association	27107012, (Europe PMC)	0.49	IntAct
GRB2	Affinity Capture-MS, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, barcode fusion genetics two hybrid, surface plasmon resonance, tandem affinity purification, two hybrid, validated two hybrid	association, direct interaction, physical, physical association	15834155, 16696976, 19380743, 21706016, 21988832, 27107012, 28514442, (Europe PMC)	0.89	BioGRID, IntAct, MINT
HCK	pull down	physical association	12029088, (Europe PMC)	0.40	IntAct, MINT
HMGB1	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
HNRNPD	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	26496610, (Europe PMC)	0.35	BioGRID, IntAct
HTT	two hybrid	physical association	17500595, (Europe PMC)	0.37	IntAct
ITSN1	Reconstituted Complex, Two-hybrid, surface plasmon resonance, two hybrid	direct interaction, physical, physical association	15834155, 16696976, 21900206, (Europe PMC)	0.71	BioGRID, IntAct, MINT
KPNB1	anti bait coimmunoprecipitation	association	16314522, (Europe PMC)	0.35	IntAct
LASP1	pull down	association	22665060, (Europe PMC)	0.35	IntAct
MAN1B1	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
MCC	anti bait coimmunoprecipitation	physical association	17353931, (Europe PMC)	0.40	IntAct
MED19	anti tag coimmunoprecipitation	association	15175163, (Europe PMC)	0.35	IntAct
MED29	anti tag coimmunoprecipitation	association	15175163, (Europe PMC)	0.35	IntAct
MPHOSPH6	two hybrid	physical association	15231747, (Europe PMC)	0.37	IntAct
MYC	anti bait coimmunoprecipitation	physical association	17353931, (Europe PMC)	0.40	IntAct
MYO1E	anti bait coimmunoprecipitation, pull down	physical association	17257598, (Europe PMC)	0.52	IntAct, MINT
NME1	pull down	association	24970086, (Europe PMC)	0.35	IntAct
NME2	anti bait coimmunoprecipitation, pull down	association, direct interaction	24970086, (Europe PMC)	0.52	IntAct
NPHP1	Proximity Label-MS, proximity-dependent biotin identification	association, physical	26638075, (Europe PMC)	0.35	BioGRID, IntAct
OFD1	Proximity Label-MS, proximity-dependent biotin identification	association, physical	26638075, (Europe PMC)	0.35	BioGRID, IntAct
PACSIN2	Affinity Capture-MS, anti bait coimmunoprecipitation, pull down	physical, physical association	16551695, 19041431, (Europe PMC)	0.52	BioGRID, IntAct, MINT
PEF1	two hybrid pooling approach	physical association	16169070, (Europe PMC)	0.37	IntAct
PEX14	Co-purification, pull down	association, physical	21525035, (Europe PMC)	0.35	BioGRID, IntAct
PLK1	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	26496610, (Europe PMC)	0.35	BioGRID, IntAct
PML	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	26496610, (Europe PMC)	0.35	BioGRID, IntAct
PPIB	two hybrid pooling approach	physical association	16169070, (Europe PMC)	0.37	IntAct
PRKAB1	anti bait coimmunoprecipitation	physical association	17353931, (Europe PMC)	0.40	IntAct
PYGM	two hybrid fragment pooling approach	physical association	23414517, (Europe PMC)	0.37	IntAct
RAB7A	anti tag coimmunoprecipitation, fluorescence microscopy	association, colocalization	20711168, (Europe PMC)	0.43	IntAct, MINT
RPGR	Proximity Label-MS, proximity-dependent biotin identification	association, physical	26638075, (Europe PMC)	0.35	BioGRID, IntAct
RPS2	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
RWDD2B	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
SH3BP4	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	physical association	16325581, (Europe PMC)	0.52	IntAct, MINT
SH3GL1	peptide array	association	10542231, (Europe PMC)	0.35	IntAct, MINT
SH3GL2	Reconstituted Complex, pull down, surface plasmon resonance	direct interaction, physical, physical association	15834155, 16696976, 17257598, (Europe PMC)	0.72	BioGRID, IntAct, MINT
SH3GL3	pull down	association	25471590, (Europe PMC)	0.35	IntAct
SH3KBP1	Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, anti bait coimmunoprecipitation, pull down	physical, physical association	19531213, 20711168, 26344197, (Europe PMC)	0.52	BioGRID, IntAct, MINT
SHC1	Affinity Capture-MS, tandem affinity purification	association, physical	19380743, (Europe PMC)	0.35	BioGRID, IntAct
SNAPIN	two hybrid fragment pooling approach	physical association	23414517, (Europe PMC)	0.37	IntAct
SNW1	Affinity Capture-MS, anti bait coimmunoprecipitation	association, physical	20467437, (Europe PMC)	0.35	BioGRID, IntAct, MINT
SNX33	pull down	physical association	18353773, (Europe PMC)	0.40	IntAct
SNX9	Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, barcode fusion genetics two hybrid, imaging technique, pull down, validated two hybrid	colocalization, direct interaction, physical, physical association	12952949, 15703209, 18388313, 27107012, 28514442, (Europe PMC)	0.81	BioGRID, IntAct, MINT
SORBS1	anti tag coimmunoprecipitation	physical association	19116150, (Europe PMC)	0.40	IntAct, MINT
SPRY2	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
SRC	Reconstituted Complex, surface plasmon resonance	direct interaction, physical	15834155, (Europe PMC)	0.44	BioGRID, IntAct, MINT
TCTN1	Proximity Label-MS, proximity-dependent biotin identification	association, physical	26638075, (Europe PMC)	0.35	BioGRID, IntAct
TIAM2	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
TYK2	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
VCAM1	Affinity Capture-MS, cross-linking study	association, physical	19738201, 22623428, (Europe PMC)	0.35	BioGRID, IntAct
WDYHV1	barcode fusion genetics two hybrid, validated two hybrid	physical association	27107012, (Europe PMC)	0.49	IntAct
XIAP	barcode fusion genetics two hybrid, validated two hybrid	physical association	27107012, (Europe PMC)	0.49	IntAct
XRCC6	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	26496610, (Europe PMC)	0.35	BioGRID, IntAct
YBX1	anti tag coimmunoprecipitation	physical association	23986595, (Europe PMC)	0.40	IntAct
ZBTB16	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
ZFAND6	two hybrid pooling approach	physical association	16169070, (Europe PMC)	0.37	IntAct

Visualize Download

Interacting partner	Detection method	Interaction type	PubMed IDs	Interaction Score	Source
AMPH	Reconstituted Complex, peptide array, surface plasmon resonance	association, direct interaction, physical	10542231, 15834155, 16696976, (Europe PMC)	0.71	BioGRID, IntAct, MINT
ATG9A	fluorescence microscopy	colocalization	24603492, (Europe PMC)	0.27	IntAct, MINT
ATXN3	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
CCDC90B	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
CCT7	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
CDC5L	Affinity Capture-MS, anti bait coimmunoprecipitation	association, physical	20467437, (Europe PMC)	0.35	BioGRID, IntAct, MINT
CTTN	Affinity Capture-Western, dynamic light scattering, molecular sieving, nuclear magnetic resonance, pull down	direct interaction, physical, physical association	16636290, (Europe PMC)	0.65	BioGRID, IntAct, MINT
DNM1	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
DYNC1I1	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
GDF9	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
GRB2	Affinity Capture-MS, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, barcode fusion genetics two hybrid, surface plasmon resonance, tandem affinity purification, two hybrid, validated two hybrid	association, direct interaction, physical, physical association	15834155, 16696976, 19380743, 21706016, 21988832, 27107012, 28514442, (Europe PMC)	0.89	BioGRID, IntAct, MINT
HCK	pull down	physical association	12029088, (Europe PMC)	0.40	IntAct, MINT
HMGB1	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
ITSN1	Reconstituted Complex, Two-hybrid, surface plasmon resonance, two hybrid	direct interaction, physical, physical association	15834155, 16696976, 21900206, (Europe PMC)	0.71	BioGRID, IntAct, MINT
MAN1B1	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
MYO1E	anti bait coimmunoprecipitation, pull down	physical association	17257598, (Europe PMC)	0.52	IntAct, MINT
PACSIN2	Affinity Capture-MS, anti bait coimmunoprecipitation, pull down	physical, physical association	16551695, 19041431, (Europe PMC)	0.52	BioGRID, IntAct, MINT
RAB7A	anti tag coimmunoprecipitation, fluorescence microscopy	association, colocalization	20711168, (Europe PMC)	0.43	IntAct, MINT
RPS2	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
RWDD2B	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
SH3BP4	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	physical association	16325581, (Europe PMC)	0.52	IntAct, MINT
SH3GL1	peptide array	association	10542231, (Europe PMC)	0.35	IntAct, MINT
SH3GL2	Reconstituted Complex, pull down, surface plasmon resonance	direct interaction, physical, physical association	15834155, 16696976, 17257598, (Europe PMC)	0.72	BioGRID, IntAct, MINT
SH3KBP1	Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, anti bait coimmunoprecipitation, pull down	physical, physical association	19531213, 20711168, 26344197, (Europe PMC)	0.52	BioGRID, IntAct, MINT
SNW1	Affinity Capture-MS, anti bait coimmunoprecipitation	association, physical	20467437, (Europe PMC)	0.35	BioGRID, IntAct, MINT
SNX9	Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, barcode fusion genetics two hybrid, imaging technique, pull down, validated two hybrid	colocalization, direct interaction, physical, physical association	12952949, 15703209, 18388313, 27107012, 28514442, (Europe PMC)	0.81	BioGRID, IntAct, MINT
SORBS1	anti tag coimmunoprecipitation	physical association	19116150, (Europe PMC)	0.40	IntAct, MINT
SPRY2	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
SRC	Reconstituted Complex, surface plasmon resonance	direct interaction, physical	15834155, (Europe PMC)	0.44	BioGRID, IntAct, MINT
TIAM2	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
TYK2	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
ZBTB16	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT

Visualize Download

Interacting partner	Detection method	Interaction type	PubMed IDs	Interaction Score	Source
ACTB	fluorescence microscopy	colocalization	19116150, (Europe PMC)	0.27	IntAct, MINT
AHI1	Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	association, physical, physical association	22623184, (Europe PMC)	0.50	BioGRID, IntAct
AMPH	Reconstituted Complex, peptide array, surface plasmon resonance	association, direct interaction, physical	10542231, 15834155, 16696976, (Europe PMC)	0.71	BioGRID, IntAct, MINT
APP	Reconstituted Complex	physical	21244100, 21832049, (Europe PMC)	NA	BioGRID
APPL1	two hybrid fragment pooling approach	physical association	23414517, (Europe PMC)	0.37	IntAct
ATG9A	fluorescence microscopy	colocalization	24603492, (Europe PMC)	0.27	IntAct, MINT
ATXN3	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
BIN1	Protein-peptide	physical	25350771, (Europe PMC)	NA	BioGRID
BUB3	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	26496610, (Europe PMC)	0.35	BioGRID, IntAct
CCDC90B	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
CCT7	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
CD2AP	Affinity Capture-Western	physical	12672817, (Europe PMC)	NA	BioGRID
CDC5L	Affinity Capture-MS, anti bait coimmunoprecipitation	association, physical	20467437, (Europe PMC)	0.35	BioGRID, IntAct, MINT
CFTR	Affinity Capture-MS	physical	26618866, (Europe PMC)	NA	BioGRID
CNTRL	Proximity Label-MS, proximity-dependent biotin identification	association, physical	26638075, (Europe PMC)	0.35	BioGRID, IntAct
CRK	peptide array	physical association	17474147, (Europe PMC)	0.40	IntAct
CTTN	Affinity Capture-Western, dynamic light scattering, molecular sieving, nuclear magnetic resonance, pull down	direct interaction, physical, physical association	16636290, (Europe PMC)	0.65	BioGRID, IntAct, MINT
DCTN1	Proximity Label-MS, proximity-dependent biotin identification	association, physical	26638075, (Europe PMC)	0.35	BioGRID, IntAct
DDX39B	Two-hybrid, two hybrid pooling approach	physical, physical association	16169070, (Europe PMC)	0.37	BioGRID, IntAct
DNALI1	Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification	association, physical, physical association	27173435, (Europe PMC)	0.51	BioGRID, IntAct
DNM1	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
DNM2	barcode fusion genetics two hybrid, validated two hybrid	physical association	27107012, (Europe PMC)	0.49	IntAct
DNM3	Affinity Capture-MS	physical	26186194, 28514442, (Europe PMC)	NA	BioGRID
DYNC1I1	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
EGFR	Affinity Capture-MS	physical	24797263, (Europe PMC)	NA	BioGRID
EIF3L	two hybrid pooling approach	physical association	16169070, (Europe PMC)	0.37	IntAct
EPS15	Affinity Capture-Western	physical	11483962, (Europe PMC)	NA	BioGRID
ERBB2	anti bait coimmunoprecipitation	association	16314522, (Europe PMC)	0.35	IntAct
FBF1	Proximity Label-MS, proximity-dependent biotin identification	association, physical	26638075, (Europe PMC)	0.35	BioGRID, IntAct
FBXO6	Affinity Capture-MS	physical	22268729, (Europe PMC)	NA	BioGRID
FCHSD1	Affinity Capture-MS	physical	19041431, (Europe PMC)	NA	BioGRID
FER	Co-fractionation	physical	9722593, (Europe PMC)	NA	BioGRID
FGFR1OP	Proximity Label-MS, proximity-dependent biotin identification	association, physical	26638075, (Europe PMC)	0.35	BioGRID, IntAct
FN1	Affinity Capture-MS	physical	19738201, (Europe PMC)	NA	BioGRID
FNBP1	Co-localization, Reconstituted Complex, fluorescence technology, pull down	colocalization, physical, physical association	15252009, 16418535, (Europe PMC)	0.50	BioGRID, IntAct
FNBP1L	Reconstituted Complex	physical	16418535, (Europe PMC)	NA	BioGRID
GBE1	Co-fractionation	physical	26344197, (Europe PMC)	NA	BioGRID
GDF9	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
GGA1	Co-fractionation	physical	26344197, (Europe PMC)	NA	BioGRID
GOLGA2	barcode fusion genetics two hybrid, validated two hybrid	physical association	27107012, (Europe PMC)	0.49	IntAct
GRAP2	barcode fusion genetics two hybrid, validated two hybrid	physical association	27107012, (Europe PMC)	0.49	IntAct
GRB2	Affinity Capture-MS, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, barcode fusion genetics two hybrid, surface plasmon resonance, tandem affinity purification, two hybrid, validated two hybrid	association, direct interaction, physical, physical association	15834155, 16696976, 19380743, 21706016, 21988832, 27107012, 28514442, (Europe PMC)	0.89	BioGRID, IntAct, MINT
GTF2E2	Affinity Capture-MS	physical	17643375, (Europe PMC)	NA	BioGRID
GYPB	Affinity Capture-MS	physical	28514442, (Europe PMC)	NA	BioGRID
HCK	pull down	physical association	12029088, (Europe PMC)	0.40	IntAct, MINT
HMGB1	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
HNRNPD	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	26496610, (Europe PMC)	0.35	BioGRID, IntAct
HTR6	Affinity Capture-MS	physical	23027611, (Europe PMC)	NA	BioGRID
HTT	two hybrid	physical association	17500595, (Europe PMC)	0.37	IntAct
ITGA4	Affinity Capture-MS	physical	22623428, (Europe PMC)	NA	BioGRID
ITSN1	Reconstituted Complex, Two-hybrid, surface plasmon resonance, two hybrid	direct interaction, physical, physical association	15834155, 16696976, 21900206, (Europe PMC)	0.71	BioGRID, IntAct, MINT
ITSN2	Two-hybrid	physical	22558309, (Europe PMC)	NA	BioGRID
KCNN3	Affinity Capture-Western	physical	22952906, (Europe PMC)	NA	BioGRID
KDR	Affinity Capture-Western	physical	16049137, (Europe PMC)	NA	BioGRID
KPNB1	anti bait coimmunoprecipitation	association	16314522, (Europe PMC)	0.35	IntAct
LASP1	pull down	association	22665060, (Europe PMC)	0.35	IntAct
LYPD6	Affinity Capture-MS	physical	26186194, 28514442, (Europe PMC)	NA	BioGRID
MAN1B1	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
MANEA	Reconstituted Complex	physical	16696976, (Europe PMC)	NA	BioGRID
MCC	anti bait coimmunoprecipitation	physical association	17353931, (Europe PMC)	0.40	IntAct
MED19	anti tag coimmunoprecipitation	association	15175163, (Europe PMC)	0.35	IntAct
MED29	anti tag coimmunoprecipitation	association	15175163, (Europe PMC)	0.35	IntAct
MEPCE	Affinity Capture-MS	physical	17643375, (Europe PMC)	NA	BioGRID
MPHOSPH6	two hybrid	physical association	15231747, (Europe PMC)	0.37	IntAct
MPP6	Two-hybrid	physical	15231747, (Europe PMC)	NA	BioGRID
MYC	anti bait coimmunoprecipitation	physical association	17353931, (Europe PMC)	0.40	IntAct
MYO1E	anti bait coimmunoprecipitation, pull down	physical association	17257598, (Europe PMC)	0.52	IntAct, MINT
NME1	pull down	association	24970086, (Europe PMC)	0.35	IntAct
NME2	anti bait coimmunoprecipitation, pull down	association, direct interaction	24970086, (Europe PMC)	0.52	IntAct
NPHP1	Proximity Label-MS, proximity-dependent biotin identification	association, physical	26638075, (Europe PMC)	0.35	BioGRID, IntAct
NTRK1	Affinity Capture-MS	physical	25921289, (Europe PMC)	NA	BioGRID
OFD1	Proximity Label-MS, proximity-dependent biotin identification	association, physical	26638075, (Europe PMC)	0.35	BioGRID, IntAct
PACSIN1	Affinity Capture-MS	physical	19041431, (Europe PMC)	NA	BioGRID
PACSIN2	Affinity Capture-MS, anti bait coimmunoprecipitation, pull down	physical, physical association	16551695, 19041431, (Europe PMC)	0.52	BioGRID, IntAct, MINT
PACSIN3	Affinity Capture-MS	physical	19041431, (Europe PMC)	NA	BioGRID
PDE6G	Reconstituted Complex	physical	12624098, (Europe PMC)	NA	BioGRID
PDGFRA	Affinity Capture-Western	physical	21996738, (Europe PMC)	NA	BioGRID
PEF1	two hybrid pooling approach	physical association	16169070, (Europe PMC)	0.37	IntAct
PEX14	Co-purification, pull down	association, physical	21525035, (Europe PMC)	0.35	BioGRID, IntAct
PICALM	Co-fractionation	physical	22939629, (Europe PMC)	NA	BioGRID
PIK3R1	Affinity Capture-Western	physical	21996738, (Europe PMC)	NA	BioGRID
PLK1	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	26496610, (Europe PMC)	0.35	BioGRID, IntAct
PML	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	26496610, (Europe PMC)	0.35	BioGRID, IntAct
PPIB	two hybrid pooling approach	physical association	16169070, (Europe PMC)	0.37	IntAct
PRKAB1	anti bait coimmunoprecipitation	physical association	17353931, (Europe PMC)	0.40	IntAct
PSTPIP1	Affinity Capture-MS, Reconstituted Complex	physical	16418535, 19041431, (Europe PMC)	NA	BioGRID
PTPN11	Affinity Capture-Western	physical	21996738, (Europe PMC)	NA	BioGRID
PTPN13	Co-fractionation	physical	26344197, (Europe PMC)	NA	BioGRID
PYGM	two hybrid fragment pooling approach	physical association	23414517, (Europe PMC)	0.37	IntAct
RAB7A	anti tag coimmunoprecipitation, fluorescence microscopy	association, colocalization	20711168, (Europe PMC)	0.43	IntAct, MINT
RBM3	Affinity Capture-MS	physical	26472337, (Europe PMC)	NA	BioGRID
RBMS1	Co-fractionation	physical	22939629, (Europe PMC)	NA	BioGRID
RHOU	Reconstituted Complex	physical	26598620, (Europe PMC)	NA	BioGRID
RPAP2	Affinity Capture-MS	physical	17643375, (Europe PMC)	NA	BioGRID
RPE	Co-fractionation	physical	26344197, (Europe PMC)	NA	BioGRID
RPGR	Proximity Label-MS, proximity-dependent biotin identification	association, physical	26638075, (Europe PMC)	0.35	BioGRID, IntAct
RPS2	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
RTCB	Co-fractionation	physical	26344197, (Europe PMC)	NA	BioGRID
RUVBL2	Affinity Capture-MS	physical	17643375, (Europe PMC)	NA	BioGRID
RWDD2B	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
SCN2B	Affinity Capture-MS	physical	26186194, 28514442, (Europe PMC)	NA	BioGRID
SH3BP4	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	physical association	16325581, (Europe PMC)	0.52	IntAct, MINT
SH3GL1	peptide array	association	10542231, (Europe PMC)	0.35	IntAct, MINT
SH3GL2	Reconstituted Complex, pull down, surface plasmon resonance	direct interaction, physical, physical association	15834155, 16696976, 17257598, (Europe PMC)	0.72	BioGRID, IntAct, MINT
SH3GL3	pull down	association	25471590, (Europe PMC)	0.35	IntAct
SH3KBP1	Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, anti bait coimmunoprecipitation, pull down	physical, physical association	19531213, 20711168, 26344197, (Europe PMC)	0.52	BioGRID, IntAct, MINT
SHANK1	Affinity Capture-Western, Reconstituted Complex, Two-hybrid	physical	11583995, (Europe PMC)	NA	BioGRID
SHANK2	Affinity Capture-Western, Reconstituted Complex, Two-hybrid	physical	11583995, (Europe PMC)	NA	BioGRID
SHC1	Affinity Capture-MS, tandem affinity purification	association, physical	19380743, (Europe PMC)	0.35	BioGRID, IntAct
SIRT7	Affinity Capture-MS	physical	22586326, (Europe PMC)	NA	BioGRID
SLC30A5	Co-fractionation	physical	22939629, (Europe PMC)	NA	BioGRID
SNAPIN	two hybrid fragment pooling approach	physical association	23414517, (Europe PMC)	0.37	IntAct
SNW1	Affinity Capture-MS, anti bait coimmunoprecipitation	association, physical	20467437, (Europe PMC)	0.35	BioGRID, IntAct, MINT
SNX18	Affinity Capture-Western	physical	26923255, (Europe PMC)	NA	BioGRID
SNX33	pull down	physical association	18353773, (Europe PMC)	0.40	IntAct
SNX9	Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, barcode fusion genetics two hybrid, imaging technique, pull down, validated two hybrid	colocalization, direct interaction, physical, physical association	12952949, 15703209, 18388313, 27107012, 28514442, (Europe PMC)	0.81	BioGRID, IntAct, MINT
SORBS1	anti tag coimmunoprecipitation	physical association	19116150, (Europe PMC)	0.40	IntAct, MINT
SPRY2	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
SRC	Reconstituted Complex, surface plasmon resonance	direct interaction, physical	15834155, (Europe PMC)	0.44	BioGRID, IntAct, MINT
STAU1	Affinity Capture-MS	physical	23125841, (Europe PMC)	NA	BioGRID
TBC1D15	Affinity Capture-MS	physical	28514442, (Europe PMC)	NA	BioGRID
TCTN1	Proximity Label-MS, proximity-dependent biotin identification	association, physical	26638075, (Europe PMC)	0.35	BioGRID, IntAct
TES	Affinity Capture-MS	physical	28378594, (Europe PMC)	NA	BioGRID
TIAM2	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
TMEM9B	Affinity Capture-MS	physical	28514442, (Europe PMC)	NA	BioGRID
TRIM25	Affinity Capture-RNA	physical	29117863, (Europe PMC)	NA	BioGRID
TRIP10	Affinity Capture-MS, Reconstituted Complex	physical	16418535, 19041431, (Europe PMC)	NA	BioGRID
TYK2	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
VCAM1	Affinity Capture-MS, cross-linking study	association, physical	19738201, 22623428, (Europe PMC)	0.35	BioGRID, IntAct
WBP4	Reconstituted Complex	physical	16055720, (Europe PMC)	NA	BioGRID
WDYHV1	barcode fusion genetics two hybrid, validated two hybrid	physical association	27107012, (Europe PMC)	0.49	IntAct
WIPI2	Affinity Capture-MS	physical	20562859, (Europe PMC)	NA	BioGRID
XIAP	barcode fusion genetics two hybrid, validated two hybrid	physical association	27107012, (Europe PMC)	0.49	IntAct
XRCC6	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	26496610, (Europe PMC)	0.35	BioGRID, IntAct
YBX1	anti tag coimmunoprecipitation	physical association	23986595, (Europe PMC)	0.40	IntAct
ZBBX	Affinity Capture-MS	physical	28514442, (Europe PMC)	NA	BioGRID
ZBTB16	Two-hybrid, two hybrid	physical, physical association	21900206, (Europe PMC)	0.37	BioGRID, IntAct, MINT
ZFAND6	two hybrid pooling approach	physical association	16169070, (Europe PMC)	0.37	IntAct

Top

DNM2