DEPOD - human DEPhOsphorylation Database

Gene Name	CDC5L (QuickGO)	Interactive visualization of CDC5L structures (A quick tutorial to explore the interctive visulaization) Representative structure: 2DIM
Synonyms	CDC5L, KIAA0432, PCDC5RP,
Protein Name	CDC5L
Alternative Name(s)	Cell division cycle 5-like protein;Cdc5-like protein;Pombe cdc5-related protein;
Protein Family	Belongs to the CEF1 family
EntrezGene ID	988 (Comparitive Toxicogenomics)
UniProt AC (Human)	Q99459 (protein sequence)
Enzyme Class	N/A
Molecular Weight	92251 Dalton
Protein Length	802 amino acids (AA)
Genome Browsers	NCBI \|
Crosslinking annotations	Query our ID-mapping table
Orthologues	Quest For Orthologues (QFO) \| GeneTree

Protein Domain	InterPro \| Pfam \| SMART	3D Structure	PDB \| DrugPort \| ModBase \| SwissModel
Polypeptide organization (Pfam)
Gene Expression	Gene Expression Atlas The Human Protein Atlas	Disease	OMIM \| ClinVar
Protein-protein interactions	STRING \| IntAct \| MINT \| BioGRID
Phosphosites	Phospho.ELM \| PhosphoSitePlus

Localization (UniProt annotation)
Nucleus Nucleusspeckle Cytoplasm Note=May shuttle between cytoplasmand nucleus
Function (UniProt annotation)
DNA-binding protein involved in cell cycle control Mayact as a transcription activator Component of the PRP19-CDC5Lcomplex that forms an integral part of the spliceosome and isrequired for activating pre-mRNA splicing The PRP19-CDC5L complexmay also play a role in the response to DNA damage (DDR)
Catalytic Activity (UniProt annotation)
N/A
Protein Sequence
MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWSREEEEKLLHLAKLMPT QWRTIAPIIGRTAAQCLEHYEFLLDKAAQRDNEEETTDDPRKLKPGEIDPNPETKPARPDPIDMDEDELEMLSEARARLA NTQGKKAKRKAREKQLEEARRLAALQKRRELRAAGIEIQKKRKRKRGVDYNAEIPFEKKPALGFYDTSEENYQALDADFR KLRQQDLDGELRSEKEGRDRKKDKQHLKRKKESDLPSAILQTSGVSEFTKKRSKLVLPAPQISDAELQEVVKVGQASEIA RQTAEESGITNSASSTLLSEYNVTNNSVALRTPRTPASQDRILQEAQNLMALTNVDTPLKGGLNTPLHESDFSGVTPQRQ VVQTPNTVLSTPFRTPSNGAEGLTPRSGTTPKPVINSTPGRTPLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGL LGLPAPKNDFEIVLPENAEKELEEREIDDTYIEDAADVDARKQAIRDAERVKEMKRMHKAVQKDLPRPSEVNETILRPLN VEPPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKGKTVGFGTNNSEHITYLEHNPYEKFSKEELKKAQDVLVQEM EVVKQGMSHGELSSEAYNQVWEECYSQVLYLPGQSRYTRANLASKKDRIESLEKRLEINRGHMTTEAKRAAKMEKKMKIL LGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKS KF

ELM Motif	Motif Instance	Description	Motif Regex
NA	NA	NA	NA

GO:0000278	P:mitotic cell cycle
GO:0000398	P:mRNA splicing
GO:0000974	via spliceosome
GO:0000977	C:Prp19 complex
GO:0000981	F:RNA polymerase II regulatory region sequence-specific DNA binding
GO:0001135	F:RNA polymerase II transcription factor activity
GO:0001222	sequence-specific DNA binding
GO:0001228	F:RNA polymerase II transcription factor recruiting activity
GO:0003677	F:transcription corepressor binding
GO:0003723	F:transcriptional activator activity
GO:0005634	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0005654	F:DNA binding
GO:0005737	F:RNA binding
GO:0006281	C:nucleus
GO:0006357	C:nucleoplasm
GO:0008157	C:cytoplasm
GO:0016020	P:DNA repair
GO:0016607	P:regulation of transcription by RNA polymerase II
GO:0019901	F:protein phosphatase 1 binding
GO:0030154	C:membrane
GO:0032993	C:nuclear speck
GO:0043522	F:protein kinase binding
GO:0043565	P:cell differentiation
GO:0044212	C:protein-DNA complex
GO:0044344	F:leucine zipper domain binding
GO:0045944	F:sequence-specific DNA binding
GO:0048471	F:transcription regulatory region DNA binding
GO:0071007	P:cellular response to fibroblast growth factor stimulus
GO:0071013	P:positive regulation of transcription by RNA polymerase II
GO:0071352	C:perinuclear region of cytoplasm
GO:0071987	C:U2-type catalytic step 2 spliceosome
GO:0072422	C:catalytic step 2 spliceosome
GO:1904568	P:cellular response to interleukin-2
GO:1990090	F:WD40-repeat domain binding
GO:1990646	P:signal transduction involved in DNA damage checkpoint
	P:cellular response to wortmannin

CDC5L is dephosphorylated by following phosphatases:

Phosphatase Gene Name	Phosphatase UniProt_AC	DephosphoSite and sequence (+/-5) in CDC5L (Q99459)	Bioassay Type	PubMed ID	View in Europe PMC	Reliability of the interaction
PPP1CB	P62140	NA_NA,	in vitro	22940584,	Europe PMC

Pathway ID	Pathway Name	Pathway Description (KEGG)
hsa03040	Spliceosome	After transcription, eukaryotic mRNA precursors contain protein-coding exons and noncoding introns. In the following splicing, introns are excised and exons are joined by a macromolecular complex, the spliceosome. The standard spliceosome is made up of five small nuclear ribonucleoproteins (snRNPs), U1, U2, U4, U5, and U6 snRNPs, and several spliceosome-associated proteins (SAPs). Spliceosomes are not a simple stable complex, but a dynamic family of particles that assemble on the mRNA precursor and help fold it into a conformation that allows transesterification to proceed. Various spliceosome forms (e.g. A-, B- and C-complexes) have been identified.

Pathway ID	Pathway Name	Pathway Description (KEGG)
R-HSA-72163	mRNA Splicing - Major Pathway.	The splicing of pre-mRNA occurs within a large, very dynamic complex, designated the 'spliceosome'. The 50-60S spliceosomes are estimated to be 40-60 nm in diameter, and have molecular weights in the range of 3-5 million kDa. Small nuclear RNAs (snRNAs) U1, U2, U4, U5, and U6, are some of the best characterized components of spliceosomes, and are known to play key roles not only in spliceosomal assembly, but also in the two catalytic steps of the splicing reaction. Over 150 proteins have been detected in spliceosomes, and only a subset of these has been characterized. The characterization, and the determination of the functions of the protein components of the spliceosome, is still work in progress. During spliceosome assembly, the snRNAs and the spliceosomal proteins assemble on the pre-mRNA in a stepwise pathway. First the E complex forms, followed by complexes A and B; the C complex forms next and contains the products of the first step of the splicing reaction. Complexes called i and D form as a consequence of the second step of the splicing reaction, which contain the excised intron and the spliced exons, respectively

Sorry, no BioGRID interacting protein information here!
[Feedback|Contribution]

Sorry, no IntAct interacting protein information here!
[Feedback|Contribution]

Sorry, no MINT interacting protein information here!
[Feedback|Contribution]

Sorry, no interacting protein information on this protein!
[Feedback|Contribution]

Sorry, no kinases are known to phosphorylate this protein!
[Feedback|Contribution]

Top