Top
CANX
Localization (UniProt annotation) Endoplasmic reticulum membrane Endoplasmic reticulum MelanosomeNote=Identified by mass spectrometry in melanosome fractions fromstage I to stage IV (PubMed:12643545, PubMed:17081065) Thepalmitoylated form preferentially localizes to the perinuclearrough ER (PubMed:22314232) Function (UniProt annotation) Calcium-binding protein that interacts with newlysynthesized glycoproteins in the endoplasmic reticulum It may actin assisting protein assembly and/or in the retention within theER of unassembled protein subunits It seems to play a major rolein the quality control apparatus of the ER by the retention ofincorrectly folded proteins Associated with partial T-cellantigen receptor complexes that escape the ER of immaturethymocytes, it may function as a signaling complex regulatingthymocyte maturation Additionally it may play a role in receptor-mediated endocytosis at the synapse Catalytic Activity (UniProt annotation) N/A Protein Sequence MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVYFADSFDRGTL
SGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIEC
GGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTL
ILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVKPDDWDEDAPAKIPDEEATKP
EGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPRCESAPGCGVWQRPVIDNPNYKGKWKPPMIDNPSYQGIWKPR
KIPNPDFFEDLEPFRMTPFSAIGLELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEER
PWLWVVYILTVALPVFLVILFCCSGKKQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEEKQKSDAEEDG
GTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE
ELM Motif Motif Instance
Description Motif Regex NA NA NA NA
CANX is dephosphorylated by following phosphatases:
Pathway ID Pathway Name Pathway Description (KEGG) hsa04141 Protein processing in endoplasmic reticulum The endoplasmic reticulum (ER) is a subcellular organelle where proteins are folded with the help of lumenal chaperones. Newly synthesized peptides enter the ER via the sec61 pore and are glycosylated. Correctly folded proteins are packaged into transport vesicles that shuttle them to the Golgi complex. Misfolded proteins are retained within the ER lumen in complex with molecular chaperones. Proteins that are terminally misfolded bind to BiP and are directed toward degradation through the proteasome in a process called ER-associated degradation (ERAD). Accumulation of misfolded proteins in the ER causes ER stress and activates a signaling pathway called the unfolded protein response (UPR). In certain severe situations, however, the protective mechanisms activated by the UPR are not sufficient to restore normal ER function and cells die by apoptosis. hsa04145 Phagosome Phagocytosis is the process of taking in relatively large particles by a cell, and is a central mechanism in the tissue remodeling, inflammation, and defense against infectious agents. A phagosome is formed when the specific receptors on the phagocyte surface recognize ligands on the particle surface. After formation, nascent phagosomes progressively acquire digestive characteristics. This maturation of phagosomes involves regulated interaction with the other membrane organelles, including recycling endosomes, late endosomes and lysosomes. The fusion of phagosomes and lysosomes releases toxic products that kill most bacteria and degrade them into fragments. However, some bacteria have strategies to escape the bactericidal mechanisms associated with phagocytosis and survive within host phagocytes. hsa04612 Antigen processing and presentation hsa04918 Thyroid hormone synthesis Thyroid hormones triiodothyronine (T3) and thyroxine (T4) are essential for normal development, growth and metabolic homeostasis in all vertebrates, and synthesized in the thyroid gland. The functional unit of the thyroid gland is the follicle, delimited by a monolayer of thyrocytes. Polarized thyrocytes surround the follicular lumen; with their basal and apical surfaces facing the bloodstream and the lumen, respectively. To synthesize thyroid hormones, thyrocytes take up iodide at their basal side and concentrate it into the lumen. They also secrete in this lumen the specialized protein thyroglobulin (TG) which serves as a store for the hormones. In the follicular lumen oxidation of iodine, iodination of tyrosines (MIT, 3-monoiodotyrosine; DIT, 3,5-diiodotyrosine) and coupling of iodotyrosines takes place on tyrosine residues in TG, resulting in T3 and T4 synthesis. Iodinated TG is resorbed through the apical membrane and degraded to form T3/T4 in lysosomes; the T3/T4 is then secreted through the basal membrane. hsa05166 Human T-cell leukemia virus 1 infection Human T-cell leukemia virus type 1 (HTLV-1) is a pathogenic retrovirus that is associated with adult T-cell leukemia/lymphoma (ATL). It is also strongly implicated in non-neoplastic chronic inflammatory diseases such as HTLV-1-associated myelopathy/tropical spastic paraparesis (HAM/TSP). Expression of Tax, a viral regulatory protein is critical to the pathogenesis. Tax is a transcriptional co-factor that interfere several signaling pathways related to anti-apoptosis or cell proliferation. The modulation of the signaling by Tax involve its binding to transcription factors like CREB/ATF, NF-kappa B, SRF, and NFAT.
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-168316 Assembly of Viral Components at the Budding Site. Following synthesis on membrane-bound ribosomes, the three viral integral membrane proteins, HA (hemagglutinin), NA (neuraminidase) and M2 (ion channel) enter the host endoplasmic reticulum (ER) where all three are folded and HA and NA are glycosylated. Subsequently HA is assembled into a trimer. HA, NA and M2 are transported to the Golgi apparatus where cysteine residues on HA and M2 are palmitoylated. Furin cleaves HA into HA1 and HA2 subunits and all three proteins are directed to the virus assembly site on the apical plasma membrane via apical sorting signals. The signals for HA and NA reside on the transmembrane domains (TMD) while the sorting signal for M2 is not yet characterized. The TMDs of HA and NA also contain the signals for lipid raft association. Lipid rafts are non-ionic detergent-resistant lipid microdomains within the plasma membrane that are rich in sphingolipids and cholesterol. Examination of purified virus particles indicates that influenza virus buds preferentially from these microdomains R-HSA-2132295 MHC class II antigen presentation. Antigen presenting cells (APCs) such as B cells, dendritic cells (DCs) and monocytes/macrophages express major histocompatibility complex class II molecules (MHC II) at their surface and present exogenous antigenic peptides to CD4+ T helper cells. CD4+ T cells play a central role in immune protection. On their activation they stimulate differentiation of B cells into antibody-producing B-cell blasts and initiate adaptive immune responses. MHC class II molecules are transmembrane glycoprotein heterodimers of alpha and beta subunits. Newly synthesized MHC II molecules present in the endoplasmic reticulum bind to a chaperone protein called invariant (Ii) chain. The binding of Ii prevents the premature binding of self antigens to the nascent MHC molecules in the ER and also guides MHC molecules to endocytic compartments. In the acidic endosomal environment, Ii is degraded in a stepwise manner, ultimately to free the class II peptide-binding groove for loading of antigenic peptides. Exogenous antigens are internalized by the APC by receptor mediated endocytosis, phagocytosis or pinocytosis into endocytic compartments of MHC class II positive cells, where engulfed antigens are degraded in a low pH environment by multiple acidic proteases, generating MHC class II epitopes. Antigenic peptides are then loaded into the class II ligand-binding groove. The resulting class II peptide complexes then move to the cell surface, where they are scanned by CD4+ T cells for specific recognition (Berger & Roche 2009, Zhou & Blum 2004, Watts 2004, Landsverk et al. 2009) R-HSA-8984722 Interleukin-35 Signalling. Interleukin 35 (IL35) is an IL12 family cytokine produced by regulatory but not effector T-cells. It is a dimeric protein composed of IL-12RB2 and IL27RA chains. IL35 suppresses inflammatory responses of immune cells R-HSA-901042 Calnexin/calreticulin cycle. The unfolded protein is recognized by a chaperon protein (calnexin or calreticulin) and the folding process starts. The binding of these protein requires a mono-glucosylated glycan (Caramelo JJ and Parodi AJ, 2008), but in certain cases can occur even in the absence of glycosylation (Ireland BS et al, 2008) R-HSA-9020956 Interleukin-27 signaling. Interleukin-27 (IL27) is a heterodimeric cytokine that contains Epstein-Barr virus–induced gene 3 (EBI3) and IL27p28 (IL27). It signals through a receptor composed of Interleukin-6 receptor subunit beta (IL6ST, gp130), which is utilized by many cytokines, and Interleukin-27 receptor subunit alpha (IL27RA, WSX-1, TCCR) (Yoshida & Hunter 2015) R-HSA-983170 Antigen Presentation: Folding, assembly and peptide loading of class I MHC. Unlike other glycoproteins, correct folding of MHC class I molecules is not sufficient to trigger their exit from the ER, they exit only after peptide loading. Described here is the process of antigen presentation which consists of the folding, assembly, and peptide loading of MHC class I molecules. The newly synthesized MHC class I Heavy Chain (HC) is initially folded with the help of several chaperones (calnexin, BiP, ERp57) and then binds with Beta-2-microglobulin (B2M). This MHC:B2M heterodimer enters the peptide loading complex (PLC), a multiprotein complex that includes calreticulin, endoplasmic reticulum resident protein 57 (ERp57), transporter associated with antigen processing (TAP) and tapasin. Peptides generated from Ub-proteolysis are transported into the ER through TAP. These peptides are further trimmed by ER-associated aminopeptidase (ERAP) and loaded on to MHC class I molecules. Stable MHC class I trimers with high-affinity peptide are transported from the ER to the cell surface by the Golgi apparatus
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABCC1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ABCC3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ACADM Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ACP5 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID ADAM21 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ADAM30 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ADGRG5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ADRB2 Affinity Capture-MS physical 23798571 , (Europe PMC )NA BioGRID AGT Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID AMFR Affinity Capture-MS physical 21343306 , (Europe PMC )NA BioGRID AMIGO3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID APMAP Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID APOB Affinity Capture-Western physical 14498830 , 9765244 , (Europe PMC )NA BioGRID ARSG Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ASGR1 Affinity Capture-Western physical 23233672 , (Europe PMC )NA BioGRID ATF2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 22304920 , (Europe PMC )0.35 BioGRID, IntAct ATL3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ATP13A1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ATP1B1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ATP2B1 Co-fractionation, proximity-dependent biotin identification association, physical 26344197 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct ATP2B3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ATP2B4 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ATXN3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct B3GNT3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID BCAP31 Affinity Capture-Western, Co-fractionation, proximity-dependent biotin identification association, physical 11851433 , 11917123 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct BMI1 Affinity Capture-MS physical 24457600 , (Europe PMC )NA BioGRID BRINP2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID BSCL2 Affinity Capture-Western physical 17387721 , (Europe PMC )NA BioGRID C12orf49 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CALR Affinity Capture-Western physical 10436013 , (Europe PMC )NA BioGRID CAND1 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CCDC8 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID CCNJL Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CCT3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CCT4 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CCT6A Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CD1B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CD1D Affinity Capture-Western physical 12239218 , (Europe PMC )NA BioGRID CD1E Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CD3D Affinity Capture-Western, Co-localization, proximity ligation assay physical, physical association 25241761 , 8621641 , (Europe PMC )0.40 BioGRID, IntAct CDC73 Affinity Capture-MS physical 27462432 , (Europe PMC )NA BioGRID CFTR Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, coimmunoprecipitation association, physical, physical association 12208510 , 16546175 , 17110338 , 18716059 , 26618866 , (Europe PMC )0.69 BioGRID, IntAct, MINT CHMP4B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CHRNA5 Affinity Capture-Western physical 9642271 , (Europe PMC )NA BioGRID CHST14 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CHST15 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct CHST6 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CHST8 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CHST9 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CLEC2D Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CLN5 Affinity Capture-MS physical 23464991 , (Europe PMC )NA BioGRID CLTC Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CLU Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct COPB1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID COX15 Affinity Capture-MS, cross-linking study, pull down association, physical 29128334 , 29568061 , (Europe PMC )0.53 BioGRID, IntAct COX2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CPA5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CSNK2A1 Biochemical Activity, protein kinase assay phosphorylation reaction, physical 22113938 , (Europe PMC )0.44 BioGRID, IntAct CUL3 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CUL7 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID CYC1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID DARS Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID DCT Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID DDOST Co-fractionation, proximity-dependent biotin identification, pull down association, physical 26344197 , 29568061 , (Europe PMC )0.46 BioGRID, IntAct DERL1 Affinity Capture-MS physical 28137758 , (Europe PMC )NA BioGRID DLST Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct DNAJA1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID DNASE2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID DPEP3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID EBI3 Affinity Capture-Western physical 8551575 , (Europe PMC )NA BioGRID EDEM1 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation physical 12610305 , 17360537 , 21632540 , 22119785 , 24910992 , (Europe PMC )NA BioGRID EDEM2 Affinity Capture-Western physical 24910992 , (Europe PMC )NA BioGRID EDEM3 Affinity Capture-MS, Affinity Capture-Western physical 28366632 , (Europe PMC )NA BioGRID EGFR Affinity Capture-MS, tandem affinity purification association, physical 24189400 , 24797263 , 28065597 , (Europe PMC )0.35 BioGRID, IntAct ELAVL1 Affinity Capture-RNA physical 19322201 , (Europe PMC )NA BioGRID EMC1 Affinity Capture-MS, proximity-dependent biotin identification, pull down association, physical 22119785 , 29568061 , (Europe PMC )0.46 BioGRID, IntAct EPRS Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ERBB3 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct ERLIN2 Affinity Capture-MS, pull down, tandem affinity purification association, physical 21343306 , 29568061 , (Europe PMC )0.53 BioGRID, IntAct ESRRB Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID ETFA Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID EWSR1 Proximity Label-MS physical 24999758 , (Europe PMC )NA BioGRID F8 Affinity Capture-Western physical 9525969 , (Europe PMC )NA BioGRID FAM187B Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID FBXO6 Affinity Capture-MS physical 22268729 , (Europe PMC )NA BioGRID FOXRED2 Affinity Capture-MS physical 22119785 , (Europe PMC )NA BioGRID FUCA2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FUT9 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GABRA1 Affinity Capture-Western physical 26945068 , (Europe PMC )NA BioGRID GABRG2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GAL3ST1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GANAB Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID GBA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct GGT1 Affinity Capture-Western physical 21712391 , (Europe PMC )NA BioGRID GRIN1 Affinity Capture-Western physical 14732708 , (Europe PMC )NA BioGRID GXYLT1 Affinity Capture-MS, pull down association, physical 28514442 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct HDAC5 Affinity Capture-MS physical 21081666 , (Europe PMC )NA BioGRID HNRNPA1 Affinity Capture-MS physical 25324306 , (Europe PMC )NA BioGRID HSP90AA1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HSP90B1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HUWE1 Affinity Capture-MS physical 25147182 , (Europe PMC )NA BioGRID HYAL3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IDH3A Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID IGSF6 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IL27RA Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IPO9 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ITGB1 Affinity Capture-Western, proximity-dependent biotin identification, pull down association, physical 29568061 , 8163531 , (Europe PMC )0.46 BioGRID, IntAct KCNH2 Affinity Capture-MS, Affinity Capture-Western physical 17569659 , 22242185 , (Europe PMC )NA BioGRID KDSR Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID KEAP1 Affinity Capture-MS physical 27621311 , (Europe PMC )NA BioGRID KPNA2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID KPNA3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID KPNA4 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID L1CAM Affinity Capture-Western physical 22222883 , (Europe PMC )NA BioGRID LCT Affinity Capture-Western physical 11751874 , (Europe PMC )NA BioGRID LDLR Affinity Capture-Western physical 16257961 , (Europe PMC )NA BioGRID LGR4 Affinity Capture-MS physical 24639526 , (Europe PMC )NA BioGRID LIPG Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LMAN1 Co-fractionation, Co-localization, proximity-dependent biotin identification association, physical 19342655 , 26344197 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct LNPEP Affinity Capture-MS, anti tag coimmunoprecipitation, pull down association, physical 26496610 , 29568061 , (Europe PMC )0.53 BioGRID, IntAct LPA Affinity Capture-Western physical 12562843 , 9717723 , 9925657 , (Europe PMC )NA BioGRID LRP1 Affinity Capture-Western physical 14980518 , (Europe PMC )NA BioGRID MDM2 Protein-peptide physical 24583282 , (Europe PMC )NA BioGRID MOGS Co-fractionation, pull down association, physical 26344197 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct MPPE1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MTNR1A Affinity Capture-MS, Reconstituted Complex, tandem affinity purification association, physical 17215244 , 26514267 , (Europe PMC )0.53 BioGRID, IntAct MTNR1B Reconstituted Complex, tandem affinity purification association, physical 17215244 , 26514267 , (Europe PMC )0.53 BioGRID, IntAct NCEH1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID NCLN Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID NDRG1 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 17220478 , (Europe PMC )0.40 BioGRID, IntAct NPHS1 Affinity Capture-Western, Co-localization physical 24303155 , (Europe PMC )NA BioGRID NRROS Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID OGFOD3 Affinity Capture-MS, pull down association, physical 26186194 , 28514442 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct OPCML Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID OPRD1 Co-fractionation, anti tag coimmunoprecipitation association, physical, physical association 11054417 , 20528919 , (Europe PMC )0.50 BioGRID, IntAct, MINT P2RX2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID P2RX5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PC Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PDIA3 Reconstituted Complex, cosedimentation through density gradient colocalization, physical 12052826 , 22045338 , (Europe PMC )0.35 BioGRID, IntAct, MINT PDIA6 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PGRMC1 Affinity Capture-Western physical 21081644 , (Europe PMC )NA BioGRID PIGK Affinity Capture-MS physical 12582175 , (Europe PMC )NA BioGRID PKD2 Co-fractionation physical 11901144 , (Europe PMC )NA BioGRID PLTP Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PMP22 Affinity Capture-Western physical 25385046 , (Europe PMC )NA BioGRID POGLUT1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID POMK Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID POMP Co-fractionation, cosedimentation through density gradient colocalization, physical 17948026 , (Europe PMC )0.35 BioGRID, IntAct, MINT PPP2R1A Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PPT1 Affinity Capture-MS physical 25865307 , (Europe PMC )NA BioGRID PRKCSH Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID PSMC2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PTBP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PTGIR Affinity Capture-Western physical 21223948 , (Europe PMC )NA BioGRID PTPRA Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID PTPRE Affinity Capture-MS, pull down association, physical 27432908 , 28330616 , (Europe PMC )0.35 BioGRID, IntAct PTPRN Affinity Capture-MS, Proximity Label-MS physical 27432908 , 27880917 , (Europe PMC )NA BioGRID PTPRO Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID RAB1A Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RAB1B Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RAB2A Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RCN1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RFWD3 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID RNF185 Co-localization, proximity-dependent biotin identification, pull down association, physical 28273161 , 29568061 , (Europe PMC )0.46 BioGRID, IntAct RNF2 Affinity Capture-MS physical 24457600 , (Europe PMC )NA BioGRID RPA1 Affinity Capture-MS physical 24332808 , (Europe PMC )NA BioGRID RPA2 Affinity Capture-MS physical 24332808 , (Europe PMC )NA BioGRID RPA3 Affinity Capture-MS physical 24332808 , (Europe PMC )NA BioGRID RPN1 Co-fractionation, proximity-dependent biotin identification, pull down association, physical 26344197 , 29568061 , (Europe PMC )0.46 BioGRID, IntAct RPN2 Co-fractionation, cosedimentation through density gradient, proximity-dependent biotin identification, pull down association, colocalization, physical 22045338 , 22939629 , 26344197 , 29568061 , (Europe PMC )0.60 BioGRID, IntAct, MINT RPS5 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RXYLT1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SCNN1D Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SDHA Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct SEC61B Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SERPINA1 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 17380188 , (Europe PMC )0.40 BioGRID, IntAct, MINT SERPINA5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SERPINF2 Affinity Capture-Western physical 10671537 , (Europe PMC )NA BioGRID SIRT7 Affinity Capture-MS physical 22586326 , (Europe PMC )NA BioGRID SLC25A3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SLC2A1 Reconstituted Complex physical 8662691 , (Europe PMC )NA BioGRID SLC33A1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SLC4A1 Affinity Capture-Western physical 10364201 , (Europe PMC )NA BioGRID SLC6A4 Reconstituted Complex physical 10364189 , (Europe PMC )NA BioGRID SMPD1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SMURF2 Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT SOAT1 Affinity Capture-MS, cosedimentation through density gradient, cross-linking study, proximity-dependent biotin identification association, colocalization, physical 22045338 , 29128334 , 29568061 , (Europe PMC )0.64 BioGRID, IntAct, MINT SPTAN1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ST3GAL2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ST8SIA3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID STAU1 Affinity Capture-MS, proximity-dependent biotin identification association, physical 23125841 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct SUZ12 Affinity Capture-MS physical 24457600 , (Europe PMC )NA BioGRID SVIP Co-fractionation physical 17872946 , (Europe PMC )NA BioGRID TAP1 Affinity Capture-Western physical 11823531 , (Europe PMC )NA BioGRID TCF3 Affinity Capture-MS physical 22354994 , (Europe PMC )NA BioGRID TCTN1 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct TCTN2 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct TCTN3 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct TECR Co-fractionation, proximity-dependent biotin identification, pull down association, physical 26344197 , 29568061 , (Europe PMC )0.46 BioGRID, IntAct TF Reconstituted Complex physical 9312001 , (Europe PMC )NA BioGRID TMED6 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TMEM258 Affinity Capture-MS physical 26472760 , (Europe PMC )NA BioGRID TMPRSS11B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TMPRSS3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TOR1A Affinity Capture-MS, Affinity Capture-Western physical 19651773 , 23569223 , 26186194 , (Europe PMC )NA BioGRID TOR3A Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TRAF6 Co-fractionation physical 23514740 , (Europe PMC )NA BioGRID TRHDE Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TRIM25 Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID TSHR Affinity Capture-Western physical 12383251 , (Europe PMC )NA BioGRID TUFM Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID U2AF2 Affinity Capture-MS physical 26641092 , (Europe PMC )NA BioGRID UBL4A Affinity Capture-MS physical 23246001 , (Europe PMC )NA BioGRID UBXN4 Affinity Capture-Western, Co-fractionation, proximity-dependent biotin identification association, physical 16968747 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct UBXN6 Affinity Capture-MS physical 22337587 , (Europe PMC )NA BioGRID UQCRC2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID UST Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID VCP Affinity Capture-MS, Co-fractionation, cosedimentation through density gradient colocalization, physical 17948026 , 23383273 , 26344197 , (Europe PMC )0.35 BioGRID, IntAct, MINT VDAC1 Affinity Capture-MS, cosedimentation through density gradient, cross-linking study association, colocalization, physical 22045338 , 29128334 , (Europe PMC )0.53 BioGRID, IntAct, MINT WNT16 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID WNT3A Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID WNT7A Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID WWOX Affinity Capture-MS, proximity-dependent biotin identification, pull down association, physical 24550385 , 29568061 , (Europe PMC )0.46 BioGRID, IntAct YIPF3 Co-fractionation physical 21757827 , (Europe PMC )NA BioGRID ZNRF4 Affinity Capture-Western physical 21205830 , (Europe PMC )NA BioGRID
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABCA1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical association 25170080 , (Europe PMC )0.58 IntAct ABCA3 fluorescence microscopy colocalization 20863830 , (Europe PMC )0.27 IntAct, MINT ACBD3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ACBD5 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ACHE cosedimentation through density gradient colocalization 22805525 , (Europe PMC )0.35 IntAct, MINT ACSL3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ADAM15 pull down association 29568061 , (Europe PMC )0.35 IntAct ADAM9 pull down association 29568061 , (Europe PMC )0.35 IntAct ADCY9 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct AHCYL1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct AHSG proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ALDH1A2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ALDH3A2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ANKLE2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ANO6 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct APOBEC3C proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ARF6 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ARHGAP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ATAD3B pull down association 29568061 , (Europe PMC )0.35 IntAct ATF2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 22304920 , (Europe PMC )0.35 BioGRID, IntAct ATP1B3 pull down association 29568061 , (Europe PMC )0.35 IntAct ATP2A2 anti bait coimmunoprecipitation, cosedimentation through density gradient association, colocalization 20528919 , 22045338 , (Europe PMC )0.53 IntAct, MINT ATP2B1 Co-fractionation, proximity-dependent biotin identification association, physical 26344197 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct ATP5F1 pull down association 29568061 , (Europe PMC )0.35 IntAct ATP5F1C proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct ATP5H pull down association 29568061 , (Europe PMC )0.35 IntAct ATP5O pull down association 29568061 , (Europe PMC )0.35 IntAct ATP6AP1 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct ATP6AP2 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct ATP6V1F proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ATXN3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AUP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct B4GALT3 pull down association 29568061 , (Europe PMC )0.35 IntAct BANF1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct BASP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct BCAP31 Affinity Capture-Western, Co-fractionation, proximity-dependent biotin identification association, physical 11851433 , 11917123 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct BSG proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct C11orf49 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct C19orf25 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct C1orf43 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct C9orf72 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CAMLG proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CAMSAP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CANX proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct CAVIN1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CCDC113 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CCDC115 {ECO:0000303|PubMed:26833332, proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CCDC124 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CCDC47 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CD247 pull down association 24502978 , (Europe PMC )0.35 IntAct, MINT CD3D Affinity Capture-Western, Co-localization, proximity ligation assay physical, physical association 25241761 , 8621641 , (Europe PMC )0.40 BioGRID, IntAct CDCA3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CDK5RAP3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CDKAL1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CDKN2A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CFTR Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, coimmunoprecipitation association, physical, physical association 12208510 , 16546175 , 17110338 , 18716059 , 26618866 , (Europe PMC )0.69 BioGRID, IntAct, MINT CHCHD2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CHML proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CHMP4B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CHMP7 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CHP1 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct CHST15 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct CHTOP proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CKAP4 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct CLCC1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CLGN proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct CLMN proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CLTA pull down association 29568061 , (Europe PMC )0.35 IntAct CLU Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CNNM3 pull down association 29568061 , (Europe PMC )0.35 IntAct CNTNAP2 anti tag coimmunoprecipitation association, physical association 22872700 , (Europe PMC )0.50 IntAct COPB2 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct COPE proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct COPG1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct COPG2 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct COX15 Affinity Capture-MS, cross-linking study, pull down association, physical 29128334 , 29568061 , (Europe PMC )0.53 BioGRID, IntAct CPD proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CSNK2A1 Biochemical Activity, protein kinase assay phosphorylation reaction, physical 22113938 , (Europe PMC )0.44 BioGRID, IntAct CSRP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DDOST Co-fractionation, proximity-dependent biotin identification, pull down association, physical 26344197 , 29568061 , (Europe PMC )0.46 BioGRID, IntAct DDRGK1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DDX18 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DDX54 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DHX30 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DIP2A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DLAT pull down association 29568061 , (Europe PMC )0.35 IntAct DLST Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct DNAH10 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DNAJC1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DPY30 pull down association 29568061 , (Europe PMC )0.35 IntAct DSG2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DVL1P1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DVL3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DYNLL1 pull down association 29568061 , (Europe PMC )0.35 IntAct ECE1 pull down association 29568061 , (Europe PMC )0.35 IntAct EGFR Affinity Capture-MS, tandem affinity purification association, physical 24189400 , 24797263 , 28065597 , (Europe PMC )0.35 BioGRID, IntAct EGLN1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EHBP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EIF2AK3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EMC1 Affinity Capture-MS, proximity-dependent biotin identification, pull down association, physical 22119785 , 29568061 , (Europe PMC )0.46 BioGRID, IntAct EMC2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EMC3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EMC4 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EMC7 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EMC8 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EMD proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ENTPD6 pull down association 29568061 , (Europe PMC )0.35 IntAct ERBB2 tandem affinity purification association 24189400 , (Europe PMC )0.35 IntAct ERBB3 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct ERLIN1 pull down association 29568061 , (Europe PMC )0.35 IntAct ERLIN2 Affinity Capture-MS, pull down, tandem affinity purification association, physical 21343306 , 29568061 , (Europe PMC )0.53 BioGRID, IntAct ESYT1 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct ESYT2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct FAM169A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct FERMT2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct FLOT1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct FNDC3A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct FTSJ3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct GABARAPL1 anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct GABARAPL2 anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct GBA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct GLA pull down association 29568061 , (Europe PMC )0.35 IntAct GNAI3 pull down association 29568061 , (Europe PMC )0.35 IntAct GNB1 pull down association 29568061 , (Europe PMC )0.35 IntAct GNB2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct GNL3 pull down association 29568061 , (Europe PMC )0.35 IntAct GORASP2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct GPAT3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct GPAT4 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct GRAMD1A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct GRN proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct GUSB pull down association 29568061 , (Europe PMC )0.35 IntAct GXYLT1 Affinity Capture-MS, pull down association, physical 28514442 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct HADHA pull down association 29568061 , (Europe PMC )0.35 IntAct HADHB pull down association 29568061 , (Europe PMC )0.35 IntAct HAL proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct HLA-A pull down association 29568061 , (Europe PMC )0.35 IntAct HLA-C pull down association 29568061 , (Europe PMC )0.35 IntAct HMOX2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct HS6ST2 pull down association 29568061 , (Europe PMC )0.35 IntAct HSD17B12 pull down association 29568061 , (Europe PMC )0.35 IntAct HSPA5 cosedimentation through density gradient colocalization 25239945 , (Europe PMC )0.35 IntAct, MINT HSPA9 cosedimentation through density gradient colocalization 22045338 , (Europe PMC )0.35 IntAct, MINT HYOU1 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct ICMT pull down association 29568061 , (Europe PMC )0.35 IntAct IGF2R proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct IKBKG tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct IMMT pull down association 29568061 , (Europe PMC )0.35 IntAct INF2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct IP6K1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ITGB1 Affinity Capture-Western, proximity-dependent biotin identification, pull down association, physical 29568061 , 8163531 , (Europe PMC )0.46 BioGRID, IntAct JAG1 anti tag coimmunoprecipitation association 22487239 , (Europe PMC )0.35 IntAct, MINT JPH1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KSR1 confocal microscopy colocalization 20679487 , (Europe PMC )0.27 IntAct KTN1 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct LANCL1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct LASP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct LBR proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct LEMD3 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct LGALS3BP pull down association 29568061 , (Europe PMC )0.35 IntAct LIMA1 pull down association 29568061 , (Europe PMC )0.35 IntAct LMAN1 Co-fractionation, Co-localization, proximity-dependent biotin identification association, physical 19342655 , 26344197 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct LMF2 pull down association 29568061 , (Europe PMC )0.35 IntAct LNPEP Affinity Capture-MS, anti tag coimmunoprecipitation, pull down association, physical 26496610 , 29568061 , (Europe PMC )0.53 BioGRID, IntAct LRRC49 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct LRRC59 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct LSG1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct LSM8 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MACO1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MAGT1 pull down association 29568061 , (Europe PMC )0.35 IntAct MAP4K5 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MAP7D1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MAPK13 anti tag coimmunoprecipitation association 19135240 , (Europe PMC )0.35 IntAct MAPK8IP1 confocal microscopy colocalization 18286207 , (Europe PMC )0.27 IntAct MAT2A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MBTPS1 pull down association 29568061 , (Europe PMC )0.35 IntAct MIA3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MIS18A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MMGT1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MOGS Co-fractionation, pull down association, physical 26344197 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct MOSPD2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MRPL12 pull down association 29568061 , (Europe PMC )0.35 IntAct MTDH proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MTNR1A Affinity Capture-MS, Reconstituted Complex, tandem affinity purification association, physical 17215244 , 26514267 , (Europe PMC )0.53 BioGRID, IntAct MTNR1B Reconstituted Complex, tandem affinity purification association, physical 17215244 , 26514267 , (Europe PMC )0.53 BioGRID, IntAct MXRA7 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MYCBPAP proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MYO1B pull down association 29568061 , (Europe PMC )0.35 IntAct MYO1D pull down association 29568061 , (Europe PMC )0.35 IntAct MYO6 pull down association 29568061 , (Europe PMC )0.35 IntAct NACA proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NAF1 fluorescence technology colocalization 20010695 , (Europe PMC )0.35 IntAct, MINT NAGLU pull down association 29568061 , (Europe PMC )0.35 IntAct NAPA proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NAT10 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NCBP2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NCK1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NCSTN pull down association 29568061 , (Europe PMC )0.35 IntAct NDC1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NDRG1 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 17220478 , (Europe PMC )0.40 BioGRID, IntAct NDUFA13 pull down association 29568061 , (Europe PMC )0.35 IntAct NEMP1 pull down association 29568061 , (Europe PMC )0.35 IntAct NFXL1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NOP16 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NOP53 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NPLOC4 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NSDHL proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NSF proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NUP107 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NUP133 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NUP155 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NUP160 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NUP37 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NUP98 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct OGFOD3 Affinity Capture-MS, pull down association, physical 26186194 , 28514442 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct OPRD1 Co-fractionation, anti tag coimmunoprecipitation association, physical, physical association 11054417 , 20528919 , (Europe PMC )0.50 BioGRID, IntAct, MINT OSBPL11 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct OSBPL8 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct OSBPL9 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct OTUB1 anti tag coimmunoprecipitation association 26752685 , (Europe PMC )0.35 IntAct PCYOX1L pull down association 29568061 , (Europe PMC )0.35 IntAct PDCL proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PDIA3 Reconstituted Complex, cosedimentation through density gradient colocalization, physical 12052826 , 22045338 , (Europe PMC )0.35 BioGRID, IntAct, MINT PDLIM1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PDZD8 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PGAM5 pull down association 29568061 , (Europe PMC )0.35 IntAct PGRMC2 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct PHB pull down association 29568061 , (Europe PMC )0.35 IntAct PLD3 pull down association 29568061 , (Europe PMC )0.35 IntAct POLDIP2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct POMP Co-fractionation, cosedimentation through density gradient colocalization, physical 17948026 , (Europe PMC )0.35 BioGRID, IntAct, MINT PON2 pull down association 29568061 , (Europe PMC )0.35 IntAct PRAF2 imaging technique colocalization 15757671 , (Europe PMC )0.27 IntAct, MINT PRDX4 fluorescence microscopy colocalization 17644091 , (Europe PMC )0.27 IntAct, MINT PREB proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PRKAR1A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PRRC2C pull down association 29568061 , (Europe PMC )0.35 IntAct PSMB1 cosedimentation through density gradient colocalization 17948026 , (Europe PMC )0.35 IntAct, MINT PSMB5 cosedimentation through density gradient colocalization 17948026 , (Europe PMC )0.35 IntAct, MINT PTPN1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PTPRE Affinity Capture-MS, pull down association, physical 27432908 , 28330616 , (Europe PMC )0.35 BioGRID, IntAct RAB3GAP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct RAB3GAP2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct RABL3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct RBM14 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct REEP5 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct RETREG1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct REXO4 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct RFWD3 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct RINT1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct RNF185 Co-localization, proximity-dependent biotin identification, pull down association, physical 28273161 , 29568061 , (Europe PMC )0.46 BioGRID, IntAct RPL12 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association 22314232 , (Europe PMC )0.46 IntAct, MINT RPL32 pull down association 29568061 , (Europe PMC )0.35 IntAct RPL39 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct RPL7 imaging technique colocalization 17258209 , (Europe PMC )0.27 IntAct, MINT RPN1 Co-fractionation, proximity-dependent biotin identification, pull down association, physical 26344197 , 29568061 , (Europe PMC )0.46 BioGRID, IntAct RPN2 Co-fractionation, cosedimentation through density gradient, proximity-dependent biotin identification, pull down association, colocalization, physical 22045338 , 22939629 , 26344197 , 29568061 , (Europe PMC )0.60 BioGRID, IntAct, MINT RRBP1 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct RRP12 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct RTN4 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct S100A6 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SCARB1 pull down association 29568061 , (Europe PMC )0.35 IntAct SCFD1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SCIN proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SDHA Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct SEC16A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SEC22B proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SEC23A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SEC23B proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SEC24A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SEC24B proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SEC61A1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down association 22314232 , 29568061 , (Europe PMC )0.60 IntAct, MINT SEC63 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SENP2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SERPINA1 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 17380188 , (Europe PMC )0.40 BioGRID, IntAct, MINT SGK494 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SLC12A2 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct SLC25A10 pull down association 29568061 , (Europe PMC )0.35 IntAct SLC25A13 pull down association 29568061 , (Europe PMC )0.35 IntAct SLC33A1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SLC3A2 pull down association 29568061 , (Europe PMC )0.35 IntAct SLC4A7 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SLC6A15 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct SMC4 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SMCR8 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SMPD4 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SMURF2 Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT SNAP29 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SND1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SOAT1 Affinity Capture-MS, cosedimentation through density gradient, cross-linking study, proximity-dependent biotin identification association, colocalization, physical 22045338 , 29128334 , 29568061 , (Europe PMC )0.64 BioGRID, IntAct, MINT SPATS2L proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SPCS2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SPCS3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SPTBN5 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SRP72 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SRPRA proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SRPRB proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct SSR1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down association, physical association 17380188 , 22314232 , 29568061 , (Europe PMC )0.71 IntAct, MINT SSR3 pull down association 29568061 , (Europe PMC )0.35 IntAct STAT1 pull down association 26966684 , (Europe PMC )0.35 IntAct, MINT STAU1 Affinity Capture-MS, proximity-dependent biotin identification association, physical 23125841 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct STBD1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct STIM1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct STIM2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct STT3A proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct STT3B proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct STX18 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct STX5 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SWAP70 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SYAP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TACC1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TACC2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TAPT1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TBXA2R fluorescence microscopy colocalization 17644091 , (Europe PMC )0.27 IntAct, MINT TCTN1 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct TCTN2 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct TCTN3 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct TECR Co-fractionation, proximity-dependent biotin identification, pull down association, physical 26344197 , 29568061 , (Europe PMC )0.46 BioGRID, IntAct TES proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TEX2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TGFBR1 pull down association 29568061 , (Europe PMC )0.35 IntAct TMED8 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TMEM106B pull down association 29568061 , (Europe PMC )0.35 IntAct TMEM106C pull down association 29568061 , (Europe PMC )0.35 IntAct TMEM199 {ECO:0000303|PubMed:26833330, proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TMEM209 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TMEM230 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TMEM259 pull down association 29568061 , (Europe PMC )0.35 IntAct TMEM30A pull down association 29568061 , (Europe PMC )0.35 IntAct TMEM97 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct TMPO proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct TMX1 cosedimentation through density gradient, proximity-dependent biotin identification association, colocalization 22045338 , 29568061 , (Europe PMC )0.53 IntAct, MINT TMX2 cosedimentation through density gradient colocalization 22045338 , (Europe PMC )0.35 IntAct, MINT TMX3 cosedimentation through density gradient colocalization 22045338 , (Europe PMC )0.35 IntAct, MINT TMX4 cosedimentation through density gradient colocalization 22045338 , (Europe PMC )0.35 IntAct, MINT TNFRSF1A tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct TOMM20 cosedimentation through density gradient colocalization 20627101 , (Europe PMC )0.35 IntAct, MINT TOR1AIP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TOR1AIP2 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct TPGS1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TPR pull down association 29568061 , (Europe PMC )0.35 IntAct TRIM13 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TRPM7 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TRPV4 confocal microscopy colocalization 16293632 , (Europe PMC )0.27 IntAct TXNL1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct UBE2J1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct UBE2V2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct UBE4A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct UBXN4 Affinity Capture-Western, Co-fractionation, proximity-dependent biotin identification association, physical 16968747 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct UFL1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct UGT8 pull down association 29568061 , (Europe PMC )0.35 IntAct UNC5B proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct USP19 fluorescence microscopy colocalization 19465887 , (Europe PMC )0.27 IntAct, MINT VAPA proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct VAPB proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct VCP Affinity Capture-MS, Co-fractionation, cosedimentation through density gradient colocalization, physical 17948026 , 23383273 , 26344197 , (Europe PMC )0.35 BioGRID, IntAct, MINT VDAC1 Affinity Capture-MS, cosedimentation through density gradient, cross-linking study association, colocalization, physical 22045338 , 29128334 , (Europe PMC )0.53 BioGRID, IntAct, MINT VDAC2 cosedimentation through density gradient, pull down association, colocalization 22045338 , 29568061 , (Europe PMC )0.53 IntAct, MINT VEZT proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct VRK2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct WDR1 pull down association 29568061 , (Europe PMC )0.35 IntAct WDR41 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct WDR44 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct WWOX Affinity Capture-MS, proximity-dependent biotin identification, pull down association, physical 24550385 , 29568061 , (Europe PMC )0.46 BioGRID, IntAct XBP1 cosedimentation through density gradient colocalization 25239945 , (Europe PMC )0.35 IntAct, MINT YBX1 anti bait coimmunoprecipitation association 25497084 , (Europe PMC )0.35 IntAct YKT6 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct YTHDF3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ZC3HAV1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ACHE cosedimentation through density gradient colocalization 22805525 , (Europe PMC )0.35 IntAct, MINT ATP2A2 anti bait coimmunoprecipitation, cosedimentation through density gradient association, colocalization 20528919 , 22045338 , (Europe PMC )0.53 IntAct, MINT CD247 pull down association 24502978 , (Europe PMC )0.35 IntAct, MINT CFTR Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, coimmunoprecipitation association, physical, physical association 12208510 , 16546175 , 17110338 , 18716059 , 26618866 , (Europe PMC )0.69 BioGRID, IntAct, MINT HSPA5 cosedimentation through density gradient colocalization 25239945 , (Europe PMC )0.35 IntAct, MINT HSPA9 cosedimentation through density gradient colocalization 22045338 , (Europe PMC )0.35 IntAct, MINT JAG1 anti tag coimmunoprecipitation association 22487239 , (Europe PMC )0.35 IntAct, MINT JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NAF1 fluorescence technology colocalization 20010695 , (Europe PMC )0.35 IntAct, MINT OPRD1 Co-fractionation, anti tag coimmunoprecipitation association, physical, physical association 11054417 , 20528919 , (Europe PMC )0.50 BioGRID, IntAct, MINT PDIA3 Reconstituted Complex, cosedimentation through density gradient colocalization, physical 12052826 , 22045338 , (Europe PMC )0.35 BioGRID, IntAct, MINT POMP Co-fractionation, cosedimentation through density gradient colocalization, physical 17948026 , (Europe PMC )0.35 BioGRID, IntAct, MINT PRAF2 imaging technique colocalization 15757671 , (Europe PMC )0.27 IntAct, MINT PRDX4 fluorescence microscopy colocalization 17644091 , (Europe PMC )0.27 IntAct, MINT PSMB1 cosedimentation through density gradient colocalization 17948026 , (Europe PMC )0.35 IntAct, MINT PSMB5 cosedimentation through density gradient colocalization 17948026 , (Europe PMC )0.35 IntAct, MINT RPL12 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association 22314232 , (Europe PMC )0.46 IntAct, MINT RPL7 imaging technique colocalization 17258209 , (Europe PMC )0.27 IntAct, MINT RPN2 Co-fractionation, cosedimentation through density gradient, proximity-dependent biotin identification, pull down association, colocalization, physical 22045338 , 22939629 , 26344197 , 29568061 , (Europe PMC )0.60 BioGRID, IntAct, MINT SEC61A1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down association 22314232 , 29568061 , (Europe PMC )0.60 IntAct, MINT SERPINA1 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 17380188 , (Europe PMC )0.40 BioGRID, IntAct, MINT SMURF2 Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT SOAT1 Affinity Capture-MS, cosedimentation through density gradient, cross-linking study, proximity-dependent biotin identification association, colocalization, physical 22045338 , 29128334 , 29568061 , (Europe PMC )0.64 BioGRID, IntAct, MINT SSR1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down association, physical association 17380188 , 22314232 , 29568061 , (Europe PMC )0.71 IntAct, MINT STAT1 pull down association 26966684 , (Europe PMC )0.35 IntAct, MINT TBXA2R fluorescence microscopy colocalization 17644091 , (Europe PMC )0.27 IntAct, MINT TMX1 cosedimentation through density gradient, proximity-dependent biotin identification association, colocalization 22045338 , 29568061 , (Europe PMC )0.53 IntAct, MINT TMX2 cosedimentation through density gradient colocalization 22045338 , (Europe PMC )0.35 IntAct, MINT TMX3 cosedimentation through density gradient colocalization 22045338 , (Europe PMC )0.35 IntAct, MINT TMX4 cosedimentation through density gradient colocalization 22045338 , (Europe PMC )0.35 IntAct, MINT TOMM20 cosedimentation through density gradient colocalization 20627101 , (Europe PMC )0.35 IntAct, MINT USP19 fluorescence microscopy colocalization 19465887 , (Europe PMC )0.27 IntAct, MINT VCP Affinity Capture-MS, Co-fractionation, cosedimentation through density gradient colocalization, physical 17948026 , 23383273 , 26344197 , (Europe PMC )0.35 BioGRID, IntAct, MINT VDAC1 Affinity Capture-MS, cosedimentation through density gradient, cross-linking study association, colocalization, physical 22045338 , 29128334 , (Europe PMC )0.53 BioGRID, IntAct, MINT VDAC2 cosedimentation through density gradient, pull down association, colocalization 22045338 , 29568061 , (Europe PMC )0.53 IntAct, MINT XBP1 cosedimentation through density gradient colocalization 25239945 , (Europe PMC )0.35 IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AAAS proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ABCA1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical association 25170080 , (Europe PMC )0.58 IntAct ABCA3 fluorescence microscopy colocalization 20863830 , (Europe PMC )0.27 IntAct, MINT ABCC1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ABCC3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ACADM Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ACBD3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ACBD5 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ACHE cosedimentation through density gradient colocalization 22805525 , (Europe PMC )0.35 IntAct, MINT ACP5 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID ACSL3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ADAM15 pull down association 29568061 , (Europe PMC )0.35 IntAct ADAM21 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ADAM30 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ADAM9 pull down association 29568061 , (Europe PMC )0.35 IntAct ADCY9 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ADGRG5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ADRB2 Affinity Capture-MS physical 23798571 , (Europe PMC )NA BioGRID AGT Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID AHCYL1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct AHSG proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ALDH1A2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ALDH3A2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct AMFR Affinity Capture-MS physical 21343306 , (Europe PMC )NA BioGRID AMIGO3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ANKLE2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ANO6 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct APMAP Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID APOB Affinity Capture-Western physical 14498830 , 9765244 , (Europe PMC )NA BioGRID APOBEC3C proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ARF6 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ARHGAP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ARSG Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ASGR1 Affinity Capture-Western physical 23233672 , (Europe PMC )NA BioGRID ATAD3B pull down association 29568061 , (Europe PMC )0.35 IntAct ATF2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 22304920 , (Europe PMC )0.35 BioGRID, IntAct ATL3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ATP13A1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ATP1B1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ATP1B3 pull down association 29568061 , (Europe PMC )0.35 IntAct ATP2A2 anti bait coimmunoprecipitation, cosedimentation through density gradient association, colocalization 20528919 , 22045338 , (Europe PMC )0.53 IntAct, MINT ATP2B1 Co-fractionation, proximity-dependent biotin identification association, physical 26344197 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct ATP2B3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ATP2B4 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ATP5F1 pull down association 29568061 , (Europe PMC )0.35 IntAct ATP5F1C proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct ATP5H pull down association 29568061 , (Europe PMC )0.35 IntAct ATP5O pull down association 29568061 , (Europe PMC )0.35 IntAct ATP6AP1 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct ATP6AP2 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct ATP6V1F proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ATXN3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AUP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct B3GNT3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID B4GALT3 pull down association 29568061 , (Europe PMC )0.35 IntAct BANF1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct BASP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct BCAP31 Affinity Capture-Western, Co-fractionation, proximity-dependent biotin identification association, physical 11851433 , 11917123 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct BMI1 Affinity Capture-MS physical 24457600 , (Europe PMC )NA BioGRID BRINP2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID BSCL2 Affinity Capture-Western physical 17387721 , (Europe PMC )NA BioGRID BSG proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct C11orf49 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct C12orf49 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID C19orf25 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct C1orf43 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct C9orf72 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CALR Affinity Capture-Western physical 10436013 , (Europe PMC )NA BioGRID CAMLG proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CAMSAP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CAND1 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CANX proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct CAVIN1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CCDC113 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CCDC115 {ECO:0000303|PubMed:26833332, proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CCDC124 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CCDC47 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CCDC8 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID CCNJL Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CCT3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CCT4 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CCT6A Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CD1B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CD1D Affinity Capture-Western physical 12239218 , (Europe PMC )NA BioGRID CD1E Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CD247 pull down association 24502978 , (Europe PMC )0.35 IntAct, MINT CD3D Affinity Capture-Western, Co-localization, proximity ligation assay physical, physical association 25241761 , 8621641 , (Europe PMC )0.40 BioGRID, IntAct CDC73 Affinity Capture-MS physical 27462432 , (Europe PMC )NA BioGRID CDCA3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CDK5RAP3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CDKAL1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CDKN2A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CFTR Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, coimmunoprecipitation association, physical, physical association 12208510 , 16546175 , 17110338 , 18716059 , 26618866 , (Europe PMC )0.69 BioGRID, IntAct, MINT CHCHD2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CHML proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CHMP4B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CHMP7 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CHP1 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct CHRNA5 Affinity Capture-Western physical 9642271 , (Europe PMC )NA BioGRID CHST14 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CHST15 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct CHST6 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CHST8 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CHST9 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CHTOP proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CKAP4 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct CLCC1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CLEC2D Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CLGN proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct CLMN proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CLN5 Affinity Capture-MS physical 23464991 , (Europe PMC )NA BioGRID CLTA pull down association 29568061 , (Europe PMC )0.35 IntAct CLTC Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CLU Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CNNM3 pull down association 29568061 , (Europe PMC )0.35 IntAct CNTNAP2 anti tag coimmunoprecipitation association, physical association 22872700 , (Europe PMC )0.50 IntAct COPB1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID COPB2 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct COPE proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct COPG1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct COPG2 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct COX15 Affinity Capture-MS, cross-linking study, pull down association, physical 29128334 , 29568061 , (Europe PMC )0.53 BioGRID, IntAct COX2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CPA5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CPD proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CSNK2A1 Biochemical Activity, protein kinase assay phosphorylation reaction, physical 22113938 , (Europe PMC )0.44 BioGRID, IntAct CSRP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CUL3 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CUL7 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID CYC1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID DARS Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID DCT Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID DDOST Co-fractionation, proximity-dependent biotin identification, pull down association, physical 26344197 , 29568061 , (Europe PMC )0.46 BioGRID, IntAct DDRGK1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DDX18 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DDX54 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DERL1 Affinity Capture-MS physical 28137758 , (Europe PMC )NA BioGRID DHX30 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DIP2A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DLAT pull down association 29568061 , (Europe PMC )0.35 IntAct DLST Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct DNAH10 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DNAJA1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID DNAJC1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DNASE2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID DPEP3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID DPY30 pull down association 29568061 , (Europe PMC )0.35 IntAct DSG2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DVL1P1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DVL3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DYNLL1 pull down association 29568061 , (Europe PMC )0.35 IntAct EBI3 Affinity Capture-Western physical 8551575 , (Europe PMC )NA BioGRID ECE1 pull down association 29568061 , (Europe PMC )0.35 IntAct EDEM1 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation physical 12610305 , 17360537 , 21632540 , 22119785 , 24910992 , (Europe PMC )NA BioGRID EDEM2 Affinity Capture-Western physical 24910992 , (Europe PMC )NA BioGRID EDEM3 Affinity Capture-MS, Affinity Capture-Western physical 28366632 , (Europe PMC )NA BioGRID EGFR Affinity Capture-MS, tandem affinity purification association, physical 24189400 , 24797263 , 28065597 , (Europe PMC )0.35 BioGRID, IntAct EGLN1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EHBP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EIF2AK3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ELAVL1 Affinity Capture-RNA physical 19322201 , (Europe PMC )NA BioGRID EMC1 Affinity Capture-MS, proximity-dependent biotin identification, pull down association, physical 22119785 , 29568061 , (Europe PMC )0.46 BioGRID, IntAct EMC2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EMC3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EMC4 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EMC7 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EMC8 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EMD proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ENTPD6 pull down association 29568061 , (Europe PMC )0.35 IntAct EPRS Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ERBB2 tandem affinity purification association 24189400 , (Europe PMC )0.35 IntAct ERBB3 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct ERLIN1 pull down association 29568061 , (Europe PMC )0.35 IntAct ERLIN2 Affinity Capture-MS, pull down, tandem affinity purification association, physical 21343306 , 29568061 , (Europe PMC )0.53 BioGRID, IntAct ESRRB Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID ESYT1 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct ESYT2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ETFA Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID EWSR1 Proximity Label-MS physical 24999758 , (Europe PMC )NA BioGRID F8 Affinity Capture-Western physical 9525969 , (Europe PMC )NA BioGRID FAM169A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct FAM187B Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID FBXO6 Affinity Capture-MS physical 22268729 , (Europe PMC )NA BioGRID FERMT2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct FLOT1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct FNDC3A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct FOXRED2 Affinity Capture-MS physical 22119785 , (Europe PMC )NA BioGRID FTSJ3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct FUCA2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FUT9 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GABARAPL1 anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct GABARAPL2 anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct GABRA1 Affinity Capture-Western physical 26945068 , (Europe PMC )NA BioGRID GABRG2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GAL3ST1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GANAB Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID GBA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct GGT1 Affinity Capture-Western physical 21712391 , (Europe PMC )NA BioGRID GLA pull down association 29568061 , (Europe PMC )0.35 IntAct GNAI3 pull down association 29568061 , (Europe PMC )0.35 IntAct GNB1 pull down association 29568061 , (Europe PMC )0.35 IntAct GNB2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct GNL3 pull down association 29568061 , (Europe PMC )0.35 IntAct GORASP2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct GPAT3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct GPAT4 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct GRAMD1A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct GRIN1 Affinity Capture-Western physical 14732708 , (Europe PMC )NA BioGRID GRN proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct GUSB pull down association 29568061 , (Europe PMC )0.35 IntAct GXYLT1 Affinity Capture-MS, pull down association, physical 28514442 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct HADHA pull down association 29568061 , (Europe PMC )0.35 IntAct HADHB pull down association 29568061 , (Europe PMC )0.35 IntAct HAL proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct HDAC5 Affinity Capture-MS physical 21081666 , (Europe PMC )NA BioGRID HLA-A pull down association 29568061 , (Europe PMC )0.35 IntAct HLA-C pull down association 29568061 , (Europe PMC )0.35 IntAct HMOX2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct HNRNPA1 Affinity Capture-MS physical 25324306 , (Europe PMC )NA BioGRID HS6ST2 pull down association 29568061 , (Europe PMC )0.35 IntAct HSD17B12 pull down association 29568061 , (Europe PMC )0.35 IntAct HSP90AA1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HSP90B1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HSPA5 cosedimentation through density gradient colocalization 25239945 , (Europe PMC )0.35 IntAct, MINT HSPA9 cosedimentation through density gradient colocalization 22045338 , (Europe PMC )0.35 IntAct, MINT HUWE1 Affinity Capture-MS physical 25147182 , (Europe PMC )NA BioGRID HYAL3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HYOU1 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct ICMT pull down association 29568061 , (Europe PMC )0.35 IntAct IDH3A Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID IGF2R proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct IGSF6 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IKBKG tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct IL27RA Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IMMT pull down association 29568061 , (Europe PMC )0.35 IntAct INF2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct IP6K1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct IPO9 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ITGB1 Affinity Capture-Western, proximity-dependent biotin identification, pull down association, physical 29568061 , 8163531 , (Europe PMC )0.46 BioGRID, IntAct JAG1 anti tag coimmunoprecipitation association 22487239 , (Europe PMC )0.35 IntAct, MINT JPH1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KCNH2 Affinity Capture-MS, Affinity Capture-Western physical 17569659 , 22242185 , (Europe PMC )NA BioGRID KDSR Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID KEAP1 Affinity Capture-MS physical 27621311 , (Europe PMC )NA BioGRID KPNA2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID KPNA3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID KPNA4 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID KSR1 confocal microscopy colocalization 20679487 , (Europe PMC )0.27 IntAct KTN1 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct L1CAM Affinity Capture-Western physical 22222883 , (Europe PMC )NA BioGRID LANCL1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct LASP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct LBR proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct LCT Affinity Capture-Western physical 11751874 , (Europe PMC )NA BioGRID LDLR Affinity Capture-Western physical 16257961 , (Europe PMC )NA BioGRID LEMD3 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct LGALS3BP pull down association 29568061 , (Europe PMC )0.35 IntAct LGR4 Affinity Capture-MS physical 24639526 , (Europe PMC )NA BioGRID LIMA1 pull down association 29568061 , (Europe PMC )0.35 IntAct LIPG Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LMAN1 Co-fractionation, Co-localization, proximity-dependent biotin identification association, physical 19342655 , 26344197 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct LMF2 pull down association 29568061 , (Europe PMC )0.35 IntAct LNPEP Affinity Capture-MS, anti tag coimmunoprecipitation, pull down association, physical 26496610 , 29568061 , (Europe PMC )0.53 BioGRID, IntAct LPA Affinity Capture-Western physical 12562843 , 9717723 , 9925657 , (Europe PMC )NA BioGRID LRP1 Affinity Capture-Western physical 14980518 , (Europe PMC )NA BioGRID LRRC49 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct LRRC59 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct LSG1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct LSM8 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MACO1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MAGT1 pull down association 29568061 , (Europe PMC )0.35 IntAct MAP4K5 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MAP7D1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MAPK13 anti tag coimmunoprecipitation association 19135240 , (Europe PMC )0.35 IntAct MAPK8IP1 confocal microscopy colocalization 18286207 , (Europe PMC )0.27 IntAct MAT2A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MBTPS1 pull down association 29568061 , (Europe PMC )0.35 IntAct MDM2 Protein-peptide physical 24583282 , (Europe PMC )NA BioGRID MIA3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MIS18A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MMGT1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MOGS Co-fractionation, pull down association, physical 26344197 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct MOSPD2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MPPE1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MRPL12 pull down association 29568061 , (Europe PMC )0.35 IntAct MTDH proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MTNR1A Affinity Capture-MS, Reconstituted Complex, tandem affinity purification association, physical 17215244 , 26514267 , (Europe PMC )0.53 BioGRID, IntAct MTNR1B Reconstituted Complex, tandem affinity purification association, physical 17215244 , 26514267 , (Europe PMC )0.53 BioGRID, IntAct MXRA7 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MYCBPAP proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MYO1B pull down association 29568061 , (Europe PMC )0.35 IntAct MYO1D pull down association 29568061 , (Europe PMC )0.35 IntAct MYO6 pull down association 29568061 , (Europe PMC )0.35 IntAct NACA proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NAF1 fluorescence technology colocalization 20010695 , (Europe PMC )0.35 IntAct, MINT NAGLU pull down association 29568061 , (Europe PMC )0.35 IntAct NAPA proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NAT10 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NCBP2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NCEH1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID NCK1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NCLN Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID NCSTN pull down association 29568061 , (Europe PMC )0.35 IntAct NDC1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NDRG1 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 17220478 , (Europe PMC )0.40 BioGRID, IntAct NDUFA13 pull down association 29568061 , (Europe PMC )0.35 IntAct NEMP1 pull down association 29568061 , (Europe PMC )0.35 IntAct NFXL1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NOP16 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NOP53 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NPHS1 Affinity Capture-Western, Co-localization physical 24303155 , (Europe PMC )NA BioGRID NPLOC4 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NRROS Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID NSDHL proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NSF proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID NUP107 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NUP133 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NUP155 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NUP160 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NUP37 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NUP98 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct OGFOD3 Affinity Capture-MS, pull down association, physical 26186194 , 28514442 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct OPCML Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID OPRD1 Co-fractionation, anti tag coimmunoprecipitation association, physical, physical association 11054417 , 20528919 , (Europe PMC )0.50 BioGRID, IntAct, MINT OSBPL11 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct OSBPL8 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct OSBPL9 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct OTUB1 anti tag coimmunoprecipitation association 26752685 , (Europe PMC )0.35 IntAct P2RX2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID P2RX5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PC Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PCYOX1L pull down association 29568061 , (Europe PMC )0.35 IntAct PDCL proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PDIA3 Reconstituted Complex, cosedimentation through density gradient colocalization, physical 12052826 , 22045338 , (Europe PMC )0.35 BioGRID, IntAct, MINT PDIA6 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PDLIM1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PDZD8 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PGAM5 pull down association 29568061 , (Europe PMC )0.35 IntAct PGRMC1 Affinity Capture-Western physical 21081644 , (Europe PMC )NA BioGRID PGRMC2 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct PHB pull down association 29568061 , (Europe PMC )0.35 IntAct PIGK Affinity Capture-MS physical 12582175 , (Europe PMC )NA BioGRID PKD2 Co-fractionation physical 11901144 , (Europe PMC )NA BioGRID PLD3 pull down association 29568061 , (Europe PMC )0.35 IntAct PLTP Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PMP22 Affinity Capture-Western physical 25385046 , (Europe PMC )NA BioGRID POGLUT1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID POLDIP2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct POMK Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID POMP Co-fractionation, cosedimentation through density gradient colocalization, physical 17948026 , (Europe PMC )0.35 BioGRID, IntAct, MINT PON2 pull down association 29568061 , (Europe PMC )0.35 IntAct PPP2R1A Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PPT1 Affinity Capture-MS physical 25865307 , (Europe PMC )NA BioGRID PRAF2 imaging technique colocalization 15757671 , (Europe PMC )0.27 IntAct, MINT PRDX4 fluorescence microscopy colocalization 17644091 , (Europe PMC )0.27 IntAct, MINT PREB proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PRKAR1A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PRKCSH Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID PRRC2C pull down association 29568061 , (Europe PMC )0.35 IntAct PSMB1 cosedimentation through density gradient colocalization 17948026 , (Europe PMC )0.35 IntAct, MINT PSMB5 cosedimentation through density gradient colocalization 17948026 , (Europe PMC )0.35 IntAct, MINT PSMC2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PTBP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PTGIR Affinity Capture-Western physical 21223948 , (Europe PMC )NA BioGRID PTPN1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PTPRA Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID PTPRE Affinity Capture-MS, pull down association, physical 27432908 , 28330616 , (Europe PMC )0.35 BioGRID, IntAct PTPRN Affinity Capture-MS, Proximity Label-MS physical 27432908 , 27880917 , (Europe PMC )NA BioGRID PTPRO Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID RAB1A Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RAB1B Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RAB2A Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RAB3GAP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct RAB3GAP2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct RABL3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct RBM14 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct RCN1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID REEP5 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct RETREG1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct REXO4 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct RFWD3 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID RFWD3 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct RINT1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct RNF185 Co-localization, proximity-dependent biotin identification, pull down association, physical 28273161 , 29568061 , (Europe PMC )0.46 BioGRID, IntAct RNF2 Affinity Capture-MS physical 24457600 , (Europe PMC )NA BioGRID RPA1 Affinity Capture-MS physical 24332808 , (Europe PMC )NA BioGRID RPA2 Affinity Capture-MS physical 24332808 , (Europe PMC )NA BioGRID RPA3 Affinity Capture-MS physical 24332808 , (Europe PMC )NA BioGRID RPL12 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association 22314232 , (Europe PMC )0.46 IntAct, MINT RPL32 pull down association 29568061 , (Europe PMC )0.35 IntAct RPL39 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct RPL7 imaging technique colocalization 17258209 , (Europe PMC )0.27 IntAct, MINT RPN1 Co-fractionation, proximity-dependent biotin identification, pull down association, physical 26344197 , 29568061 , (Europe PMC )0.46 BioGRID, IntAct RPN2 Co-fractionation, cosedimentation through density gradient, proximity-dependent biotin identification, pull down association, colocalization, physical 22045338 , 22939629 , 26344197 , 29568061 , (Europe PMC )0.60 BioGRID, IntAct, MINT RPS5 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RRBP1 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct RRP12 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct RTN4 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct RXYLT1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID S100A6 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SCARB1 pull down association 29568061 , (Europe PMC )0.35 IntAct SCFD1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SCIN proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SCNN1D Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SDHA Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct SEC16A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SEC22B proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SEC23A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SEC23B proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SEC24A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SEC24B proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SEC61A1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down association 22314232 , 29568061 , (Europe PMC )0.60 IntAct, MINT SEC61B Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SEC63 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SENP2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SERPINA1 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 17380188 , (Europe PMC )0.40 BioGRID, IntAct, MINT SERPINA5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SERPINF2 Affinity Capture-Western physical 10671537 , (Europe PMC )NA BioGRID SGK494 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SIRT7 Affinity Capture-MS physical 22586326 , (Europe PMC )NA BioGRID SLC12A2 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct SLC25A10 pull down association 29568061 , (Europe PMC )0.35 IntAct SLC25A13 pull down association 29568061 , (Europe PMC )0.35 IntAct SLC25A3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SLC2A1 Reconstituted Complex physical 8662691 , (Europe PMC )NA BioGRID SLC33A1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SLC3A2 pull down association 29568061 , (Europe PMC )0.35 IntAct SLC4A1 Affinity Capture-Western physical 10364201 , (Europe PMC )NA BioGRID SLC4A7 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SLC6A15 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct SLC6A4 Reconstituted Complex physical 10364189 , (Europe PMC )NA BioGRID SMC4 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SMCR8 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SMPD1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SMPD4 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SMURF2 Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT SNAP29 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SND1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SOAT1 Affinity Capture-MS, cosedimentation through density gradient, cross-linking study, proximity-dependent biotin identification association, colocalization, physical 22045338 , 29128334 , 29568061 , (Europe PMC )0.64 BioGRID, IntAct, MINT SPATS2L proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SPCS2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SPCS3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SPTAN1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SPTBN5 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SRP72 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SRPRA proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SRPRB proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct SSR1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down association, physical association 17380188 , 22314232 , 29568061 , (Europe PMC )0.71 IntAct, MINT SSR3 pull down association 29568061 , (Europe PMC )0.35 IntAct ST3GAL2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ST8SIA3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID STAT1 pull down association 26966684 , (Europe PMC )0.35 IntAct, MINT STAU1 Affinity Capture-MS, proximity-dependent biotin identification association, physical 23125841 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct STBD1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct STIM1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct STIM2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct STT3A proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct STT3B proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct STX18 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct STX5 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SUZ12 Affinity Capture-MS physical 24457600 , (Europe PMC )NA BioGRID SVIP Co-fractionation physical 17872946 , (Europe PMC )NA BioGRID SWAP70 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SYAP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TACC1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TACC2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TAP1 Affinity Capture-Western physical 11823531 , (Europe PMC )NA BioGRID TAPT1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TBXA2R fluorescence microscopy colocalization 17644091 , (Europe PMC )0.27 IntAct, MINT TCF3 Affinity Capture-MS physical 22354994 , (Europe PMC )NA BioGRID TCTN1 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct TCTN2 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct TCTN3 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct TECR Co-fractionation, proximity-dependent biotin identification, pull down association, physical 26344197 , 29568061 , (Europe PMC )0.46 BioGRID, IntAct TES proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TEX2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TF Reconstituted Complex physical 9312001 , (Europe PMC )NA BioGRID TGFBR1 pull down association 29568061 , (Europe PMC )0.35 IntAct TMED6 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TMED8 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TMEM106B pull down association 29568061 , (Europe PMC )0.35 IntAct TMEM106C pull down association 29568061 , (Europe PMC )0.35 IntAct TMEM199 {ECO:0000303|PubMed:26833330, proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TMEM209 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TMEM230 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TMEM258 Affinity Capture-MS physical 26472760 , (Europe PMC )NA BioGRID TMEM259 pull down association 29568061 , (Europe PMC )0.35 IntAct TMEM30A pull down association 29568061 , (Europe PMC )0.35 IntAct TMEM97 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct TMPO proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct TMPRSS11B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TMPRSS3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TMX1 cosedimentation through density gradient, proximity-dependent biotin identification association, colocalization 22045338 , 29568061 , (Europe PMC )0.53 IntAct, MINT TMX2 cosedimentation through density gradient colocalization 22045338 , (Europe PMC )0.35 IntAct, MINT TMX3 cosedimentation through density gradient colocalization 22045338 , (Europe PMC )0.35 IntAct, MINT TMX4 cosedimentation through density gradient colocalization 22045338 , (Europe PMC )0.35 IntAct, MINT TNFRSF1A tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct TOMM20 cosedimentation through density gradient colocalization 20627101 , (Europe PMC )0.35 IntAct, MINT TOR1A Affinity Capture-MS, Affinity Capture-Western physical 19651773 , 23569223 , 26186194 , (Europe PMC )NA BioGRID TOR1AIP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TOR1AIP2 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct TOR3A Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TPGS1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TPR pull down association 29568061 , (Europe PMC )0.35 IntAct TRAF6 Co-fractionation physical 23514740 , (Europe PMC )NA BioGRID TRHDE Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TRIM13 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TRIM25 Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID TRPM7 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TRPV4 confocal microscopy colocalization 16293632 , (Europe PMC )0.27 IntAct TSHR Affinity Capture-Western physical 12383251 , (Europe PMC )NA BioGRID TUFM Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TXNL1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct U2AF2 Affinity Capture-MS physical 26641092 , (Europe PMC )NA BioGRID UBE2J1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct UBE2V2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct UBE4A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct UBL4A Affinity Capture-MS physical 23246001 , (Europe PMC )NA BioGRID UBXN4 Affinity Capture-Western, Co-fractionation, proximity-dependent biotin identification association, physical 16968747 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct UBXN6 Affinity Capture-MS physical 22337587 , (Europe PMC )NA BioGRID UFL1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct UGT8 pull down association 29568061 , (Europe PMC )0.35 IntAct UNC5B proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct UQCRC2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID USP19 fluorescence microscopy colocalization 19465887 , (Europe PMC )0.27 IntAct, MINT UST Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID VAPA proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct VAPB proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct VCP Affinity Capture-MS, Co-fractionation, cosedimentation through density gradient colocalization, physical 17948026 , 23383273 , 26344197 , (Europe PMC )0.35 BioGRID, IntAct, MINT VDAC1 Affinity Capture-MS, cosedimentation through density gradient, cross-linking study association, colocalization, physical 22045338 , 29128334 , (Europe PMC )0.53 BioGRID, IntAct, MINT VDAC2 cosedimentation through density gradient, pull down association, colocalization 22045338 , 29568061 , (Europe PMC )0.53 IntAct, MINT VEZT proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct VRK2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct WDR1 pull down association 29568061 , (Europe PMC )0.35 IntAct WDR41 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct WDR44 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct WNT16 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID WNT3A Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID WNT7A Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID WWOX Affinity Capture-MS, proximity-dependent biotin identification, pull down association, physical 24550385 , 29568061 , (Europe PMC )0.46 BioGRID, IntAct XBP1 cosedimentation through density gradient colocalization 25239945 , (Europe PMC )0.35 IntAct, MINT YBX1 anti bait coimmunoprecipitation association 25497084 , (Europe PMC )0.35 IntAct YIPF3 Co-fractionation physical 21757827 , (Europe PMC )NA BioGRID YKT6 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct YTHDF3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ZC3HAV1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ZNRF4 Affinity Capture-Western physical 21205830 , (Europe PMC )NA BioGRID
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
CDK1 S583_EDEILNRsPRNRKPR , NA NA PhosphoSitePlus , CK2_group S554_KLEEKQKsDAEEDGG , S564_EEDGGTVsQEEEDRK , LTP 9642293 ,(Europe PMC )PhosphoELM , MAPK3 S583_EDEILNRsPRNRKPR , NA NA PhosphoSitePlus , PKC_group S583_EDEILNRsPRNRKPR , LTP 9642293 ,(Europe PMC )PhosphoELM , Unknown S392_PPMIDNPsYQGIWKP , S554_KLEEKQKsDAEEDGG , S564_EEDGGTVsQEEEDRK , S583_EDEILNRsPRNRKPR , T562_DAEEDGGtVSQEEED , HTP, in vivo 16083285 , 16565220 , 17081983 , 17322306 , 17924679 , 18077418 , 18088087 , 18212344 , 18452278 , 18510355 , 18578522 , 18669648 , 18691976 , 18707149 , 18767875 , 19007248 , 19413330 , 19415658 , 19651622 , 19664995 , 19691289 , 20058876 , 20068231 , 20166139 , 9642293 ,(Europe PMC )HPRD, PhosphoELM ,