DEPOD - human DEPhOsphorylation Database

Basic Information
Substrates
Pathway
Interacting Proteins
Phosphorylating Kinases

Gene Name	UBASH3A (QuickGO)	Interactive visualization UBASH3A structures (A quick tutorial to explore the interctive visulaization)
Synonyms	UBASH3A, STS2
Protein Name	UBASH3A
Alternative Name(s)	Ubiquitin-associated and SH3 domain-containing protein A;Cbl-interacting protein 4;CLIP4;Suppressor of T-cell receptor signaling 2;STS-2;T-cell ubiquitin ligand 1;TULA-1;
EntrezGene ID	53347 (Comparitive Toxicogenomics)
UniProt AC (Human)	P57075 (protein sequence)
Enzyme Class	N/A
Molecular Weight	74123 Dalton
Protein Length	661 amino acids (AA)
Genome Browsers	NCBI \| ENSG00000160185 (Ensembl) \| UCSC
Crosslinking annotations	Query our ID-mapping table
Orthologues	Quest For Orthologues (QFO) \| GeneTree
Classification	Superfamily: histidine phosphatase (HP) \| Historic class: Phosphoglycerate mutase \| CATH ID: 3.40.50.1240 \| SCOP Fold: HP
Phosphatase activity	inactive \| Catalytic signature motif: RHGE
Phosphorylation Network	Visualize

Domain organization, Expression, Diseases

(show / hide)

Protein Domain	InterPro \| Pfam \| SMART	3D Structure	PDB \| DrugPort \| ModBase \| SwissModel
Polypeptide organization (Pfam)	No Pfam domain found
Catalytic Site	Mechanism and Catalytic Site Atlas
Gene Expression	Gene Expression Atlas The Human Protein Atlas	Diseases	OMIM \| DisGeNet \| COSMIC \| ClinVar
Protein-protein interactions	STRING \| IntAct \| MINT \| BioGRID
Phosphosites	Phospho.ELM \| PhosphoSitePlus

Localization, Function, Catalytic activity and Sequence

(show / hide)

Localization (UniProt annotation)
Cytoplasm Nucleus
Function (UniProt annotation)
Interferes with CBL-mediated down-regulation anddegradation of receptor-type tyrosine kinases Promotesaccumulation of activated target receptors, such as T-cellreceptors, EGFR and PDGFRB, on the cell surface Exhibitsnegligigle protein tyrosine phosphatase activity at neutral pHMay act as a dominant-negative regulator of UBASH3B-dependentdephosphorylation May inhibit dynamin-dependent endocyticpathways by functionally sequestering dynamin via its SH3 domain
Catalytic Activity (UniProt annotation)
NA
Protein Sequence
MAAGETQLYAKVSNKLKSRSSPSLLEPLLAMGFPVHTALKALAATGRKTAEEALAWLHDHCNDPSLDDPIPQEYALFLCP TGPLLEKLQEFWRESKRQCAKNRAHEVFPHVTLCDFFTCEDQKVECLYEALKRAGDRLLGSFPTAVPLALHSSISYLGFF VSGSPADVIREFAMTFATEASLLAGTSVSRFWIFSQVPGHGPNLRLSNLTRASFVSHYILQKYCSVKPCTKQLHLTLAHK FYPHHQRTLEQLARAIPLGHSCQWTAALYSRDMRFVHYQTLRALFQYKPQNVDELTLSPGDYIFVDPTQQDEASEGWVIG ISQRTGCRGFLPENYTDRASESDTWVKHRMYTFSLATDLNSRKDGEASSRCSGEFLPQTARSLSSLQALQATVARKSVLV VRHGERVDQIFGKAWLQQCSTPDGKYYRPDLNFPCSLPRRSRGIKDFENDPPLSSCGIFQSRIAGDALLDSGIRISSVFA SPALRCVQTAKLILEELKLEKKIKIRVEPGIFEWTKWEAGKTTPTLMSLEELKEANFNIDTDYRPAFPLSALMPAESYQE YMDRCTASMVQIVNTCPQDTGVILIVSHGSTLDSCTRPLLGLPPRECGDFAQLVRKIPSLGMCFCEENKEEGKWELVNPP VKTLTHGANAAFNWRNWISGN

Motif information from Eukaryotic Linear Motif atlas (ELM)

(show / hide)

ELM Motif	Motif Instance	Description	Motif Regex
NA	NA	NA	NA

Gene Ontology (P: Process; F: Function and C: Component terms)

(show / hide)

GO:0001817	P:regulation of cytokine production
GO:0005654	C:nucleoplasm
GO:0005794	C:Golgi apparatus
GO:0005829	C:cytosol
GO:0050860	P:negative regulation of T cell receptor signaling pathway
GO:0070062	C:extracellular exosome

Protein substrates
Non-protein substrates

Sorry, no substrate information currently!
[Feedback|Contribution]

KEGG Pathway
Reactome Pathway

Sorry, no KEGG pathway information here!
[ Feedback|Contribution]

Sorry, no REACTOME pathway information here!
[Feedback|Contribution]

BioGRID
IntAct
MINT
ALL

Visualize Download

Interacting partner	Detection method	Interaction type	PubMed IDs	Interaction Score	Source
AIFM1	Affinity Capture-Western	physical	17709377, (Europe PMC)	NA	BioGRID
ALK	Affinity Capture-MS	physical	14968112, (Europe PMC)	NA	BioGRID
CBL	Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex	physical	15107835, 15159412, 16429130, 17709377, (Europe PMC)	NA	BioGRID
CBS	Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical, physical association	25416956, (Europe PMC)	0.56	BioGRID, IntAct
CRK	Affinity Capture-MS, tandem affinity purification	association, physical	19380743, (Europe PMC)	0.35	BioGRID, IntAct
DAZAP2	Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical, physical association	21516116, 25416956, , (Europe PMC)	0.49, 0.67	BioGRID, IntAct, MINT
DNM1	Affinity Capture-Western, anti tag coimmunoprecipitation	physical, physical association	17382318, (Europe PMC)	0.40	BioGRID, IntAct, MINT
EGFR	Affinity Capture-Western	physical	15107835, 15159412, (Europe PMC)	NA	BioGRID
KCNE1	Two-hybrid	physical	25416956, (Europe PMC)	NA	BioGRID
KRT40	Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical, physical association	25416956, (Europe PMC)	0.56	BioGRID, IntAct
PRKN	Reconstituted Complex	physical	17599067, (Europe PMC)	NA	BioGRID
REL	Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical, physical association	25416956, (Europe PMC)	0.56	BioGRID, IntAct
RNF41	Affinity Capture-Western, Reconstituted Complex	physical	26390156, (Europe PMC)	NA	BioGRID
SF3B4	Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical, physical association	25416956, (Europe PMC)	0.56	BioGRID, IntAct
SPRY2	Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical, physical association	21516116, 25416956, (Europe PMC)	0.67	BioGRID, IntAct, MINT
TP53BP2	Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical, physical association	25416956, (Europe PMC)	0.56	BioGRID, IntAct
TRIM37	Two-hybrid	physical	25416956, (Europe PMC)	NA	BioGRID
UBASH3A	Affinity Capture-Western	physical	15159412, (Europe PMC)	NA	BioGRID
UBASH3B	Affinity Capture-MS	physical	19380743, (Europe PMC)	NA	BioGRID
UBC	Reconstituted Complex, pull down	physical, physical association	15159412, 16429130, 17599067, (Europe PMC)	0.40	BioGRID, IntAct, MINT
UBE2L3	FRET	physical	17588522, (Europe PMC)	NA	BioGRID

Visualize Download

Interacting partner	Detection method	Interaction type	PubMed IDs	Interaction Score	Source
CRK	Affinity Capture-MS, tandem affinity purification	association, physical	19380743, (Europe PMC)	0.35	BioGRID, IntAct
DAZAP2	Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical, physical association	21516116, 25416956, , (Europe PMC)	0.49, 0.67	BioGRID, IntAct, MINT
DNM1	Affinity Capture-Western, anti tag coimmunoprecipitation	physical, physical association	17382318, (Europe PMC)	0.40	BioGRID, IntAct, MINT
EBI-1108795	anti bait coimmunoprecipitation	association	14968112, (Europe PMC)	0.35	IntAct
KRT40	Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical, physical association	25416956, (Europe PMC)	0.56	BioGRID, IntAct
PRKN	pull down	physical association	17599067, (Europe PMC)	0.40	IntAct, MINT
REL	Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical, physical association	25416956, (Europe PMC)	0.56	BioGRID, IntAct
SF3B4	Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical, physical association	25416956, (Europe PMC)	0.56	BioGRID, IntAct
SPRY2	Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical, physical association	21516116, 25416956, (Europe PMC)	0.67	BioGRID, IntAct, MINT
TP53BP2	Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical, physical association	25416956, (Europe PMC)	0.56	BioGRID, IntAct
TRIM37	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	25416956, (Europe PMC)	0.56	IntAct
UBC	Reconstituted Complex, pull down	physical, physical association	15159412, 16429130, 17599067, (Europe PMC)	0.40	BioGRID, IntAct, MINT

Visualize Download

Interacting partner	Detection method	Interaction type	PubMed IDs	Interaction Score	Source
DNM1	Affinity Capture-Western, anti tag coimmunoprecipitation	physical, physical association	17382318, (Europe PMC)	0.40	BioGRID, IntAct, MINT
PRKN	pull down	physical association	17599067, (Europe PMC)	0.40	IntAct, MINT
SPRY2	Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical, physical association	21516116, 25416956, (Europe PMC)	0.67	BioGRID, IntAct, MINT
UBC	Reconstituted Complex, pull down	physical, physical association	15159412, 16429130, 17599067, (Europe PMC)	0.40	BioGRID, IntAct, MINT

Visualize Download

Interacting partner	Detection method	Interaction type	PubMed IDs	Interaction Score	Source
AIFM1	Affinity Capture-Western	physical	17709377, (Europe PMC)	NA	BioGRID
ALK	Affinity Capture-MS	physical	14968112, (Europe PMC)	NA	BioGRID
CBL	Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex	physical	15107835, 15159412, 16429130, 17709377, (Europe PMC)	NA	BioGRID
CBS	Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical, physical association	25416956, (Europe PMC)	0.56	BioGRID, IntAct
CRK	Affinity Capture-MS, tandem affinity purification	association, physical	19380743, (Europe PMC)	0.35	BioGRID, IntAct
DAZAP2	Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical, physical association	21516116, 25416956, , (Europe PMC)	0.49, 0.67	BioGRID, IntAct, MINT
DNM1	Affinity Capture-Western, anti tag coimmunoprecipitation	physical, physical association	17382318, (Europe PMC)	0.40	BioGRID, IntAct, MINT
EBI-1108795	anti bait coimmunoprecipitation	association	14968112, (Europe PMC)	0.35	IntAct
EGFR	Affinity Capture-Western	physical	15107835, 15159412, (Europe PMC)	NA	BioGRID
KCNE1	Two-hybrid	physical	25416956, (Europe PMC)	NA	BioGRID
KRT40	Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical, physical association	25416956, (Europe PMC)	0.56	BioGRID, IntAct
PRKN	Reconstituted Complex	physical	17599067, (Europe PMC)	NA	BioGRID
PRKN	pull down	physical association	17599067, (Europe PMC)	0.40	IntAct, MINT
REL	Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical, physical association	25416956, (Europe PMC)	0.56	BioGRID, IntAct
RNF41	Affinity Capture-Western, Reconstituted Complex	physical	26390156, (Europe PMC)	NA	BioGRID
SF3B4	Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical, physical association	25416956, (Europe PMC)	0.56	BioGRID, IntAct
SPRY2	Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical, physical association	21516116, 25416956, (Europe PMC)	0.67	BioGRID, IntAct, MINT
TP53BP2	Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical, physical association	25416956, (Europe PMC)	0.56	BioGRID, IntAct
TRIM37	Two-hybrid	physical	25416956, (Europe PMC)	NA	BioGRID
TRIM37	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	25416956, (Europe PMC)	0.56	IntAct
UBASH3A	Affinity Capture-Western	physical	15159412, (Europe PMC)	NA	BioGRID
UBASH3B	Affinity Capture-MS	physical	19380743, (Europe PMC)	NA	BioGRID
UBC	Reconstituted Complex, pull down	physical, physical association	15159412, 16429130, 17599067, (Europe PMC)	0.40	BioGRID, IntAct, MINT
UBE2L3	FRET	physical	17588522, (Europe PMC)	NA	BioGRID

Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively

Phosphorylating Kinases	Phosphoresidues	Detection Method	PubMed IDs	Source
Unknown	S439_NFPCSLPsRSRGIKD, S477_DSGIRISsVFASPAL,	in vivo	20166139,(Europe PMC)	HPRD,

Top

UBASH3A