- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
TIMM50
Gene Name  | TIMM50 (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | TIMM50, TIM50, PRO1512 | |
| Protein Name | TIMM50 |
|
| Alternative Name(s) |
Mitochondrial import inner membrane translocase subunit TIM50; | |
| EntrezGene ID | 92609 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q3ZCQ8 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 39646 Dalton | |
| Protein Length | 353 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000105197 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: HAD --> Family: FCP | Historic class: PSTPs --> FCP/SCP | CATH ID: 3.40.50.1000 | SCOP Fold: HAD | |
| Phosphatase activity | active | Catalytic signature motif: unknown | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Mitochondrion inner membrane Isoform 2: Nucleus speckle Note=Nuclear and enriched inspeckles with snRNPs | |||
| Function (UniProt annotation) | |||
| Essential component of the TIM23 complex, a complex thatmediates the translocation of transit peptide-containing proteinsacross the mitochondrial inner membrane Has some phosphataseactivity in vitro; however such activity may not be relevant invivo Isoform 2: May participate in the release of snRNPs andSMN from the Cajal body | |||
| Catalytic Activity (UniProt annotation) | |||
| NA | |||
| Protein Sequence | |||
| MAASAAVFSRLRSGLRLGSRGLCTRLATPPRRAPDQAAEIGSRGSTKAQGPQQQPGSEGPSYAKKVALWLAGLLGAGGTV SVVYIFGNNPVDENGAKIPDEFDNDPILVQQLRRTYKYFKDYRQMIIEPTSPCLLPDPLQEPYYQPPYTLVLELTGVLLH PEWSLATGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRD PARVVVVDCKKEAFRLQPYNGVALRPWDGNSDDRVLLDLSAFLKTIALNGVEDVRTVLEHYALEDDPLAAFKQRQSRLEQ EEQQRLAELSKSNKQNLFLGSLTSRLWPRSKQP |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0001836 | P:release of cytochrome c from mitochondria |
| GO:0003723 | F:RNA binding |
| GO:0004721 | F:phosphoprotein phosphatase activity |
| GO:0004722 | F:protein serine/threonine phosphatase activity |
| GO:0004725 | F:protein tyrosine phosphatase activity |
| GO:0005134 | F:interleukin-2 receptor binding |
| GO:0005654 | C:nucleoplasm |
| GO:0005739 | C:mitochondrion |
| GO:0005743 | C:mitochondrial inner membrane |
| GO:0005744 | C:mitochondrial inner membrane presequence translocase complex |
| GO:0006470 | P:protein dephosphorylation |
| GO:0007006 | P:mitochondrial membrane organization |
| GO:0016021 | C:integral component of membrane |
| GO:0016607 | C:nuclear speck |
| GO:0030150 | P:protein import into mitochondrial matrix |
| GO:0043021 | F:ribonucleoprotein complex binding |
[Feedback|Contribution]
[Feedback|Contribution]
[ Feedback|Contribution]
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-1268020 | Mitochondrial protein import. | A human mitochondrion contains about 1500 proteins, more than 99% of which are encoded in the nucleus, synthesized in the cytosol and imported into the mitochondrion. Proteins are targeted to four locations (outer membrane, intermembrane space, inner membrane, and matrix) and must be sorted accordingly (reviewed in Kutik et al. 2007, Milenkovic et al. 2007, Bolender et al. 2008, Endo and Yamano 2009, Wiedemann and Pfanner 2017, Kang et al. 2018). Newly synthesized proteins are transported from the cytosol across the outer membrane by the TOMM40:TOMM70 complex. Proteins that contain presequences first interact with the TOMM20 subunit of the complex while proteins that contain internal targeting elements first interact with the TOMM70 subunit. After initial interaction the protein is conducted across the outer membrane by TOMM40 subunits. In yeast some proteins such as Aco1, Atp1, Cit1, Idh1, and Atp2 have both presequences that interact with TOM20 and mature regions that interact with TOM70 (Yamamoto et al. 2009).After passage across the outer membrane, proteins may be targeted to the outer membrane via the SAMM50 complex, to the inner membrane via the TIMM22 or TIMM23 complexes (reviewed in van der Laan et al. 2010), to the matrix via the TIMM23 complex (reviewed in van der Laan et al. 2010), or proteins may fold and remain in the intermembrane space (reviewed in Stojanovski et al. 2008, Deponte and Hell 2009, Sideris and Tokatlidis 2010). Presequences on matrix and inner membrane proteins cause interaction with TIMM23 complexes; internal targeting sequences cause outer membrane proteins to interact with the SAMM50 complex and inner membrane proteins to interact with the TIMM22 complex. While in the intermembrane space hydrophobic proteins are chaperoned by the TIMM8:TIMM13 complex and/or the TIMM9:TIMM10:FXC1 complex |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ABI2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ACAD9 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| ADRB2 | Affinity Capture-MS | physical | 23798571, (Europe PMC) | NA | BioGRID |
| AKTIP | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| AMFR | Affinity Capture-MS | physical | 21343306, (Europe PMC) | NA | BioGRID |
| ARAF | Affinity Capture-MS, anti tag coimmunoprecipitation, two hybrid | association, physical, physical association | 12620389, 25852190, (Europe PMC) | 0.55 | BioGRID, IntAct |
| BMI1 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| BPIFB1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| BRK1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| C15orf48 | Affinity Capture-MS | physical | 27499296, (Europe PMC) | NA | BioGRID |
| CBX5 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 20562864, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CCDC8 | Affinity Capture-MS | physical | 24711643, (Europe PMC) | NA | BioGRID |
| CD55 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| CFTR | Affinity Capture-MS | physical | 26618866, (Europe PMC) | NA | BioGRID |
| CHCHD10 | Affinity Capture-MS | physical | 27499296, (Europe PMC) | NA | BioGRID |
| CHCHD2 | Affinity Capture-MS | physical | 27499296, (Europe PMC) | NA | BioGRID |
| CISD3 | Affinity Capture-MS | physical | 27499296, (Europe PMC) | NA | BioGRID |
| COQ8B | Affinity Capture-MS | physical | 27499296, (Europe PMC) | NA | BioGRID |
| COQ9 | Affinity Capture-MS | physical | 27499296, (Europe PMC) | NA | BioGRID |
| CTDSP2 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| CUL1 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CUL3 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CUL7 | Affinity Capture-MS | physical | 24711643, (Europe PMC) | NA | BioGRID |
| CYFIP1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| CYFIP2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| DNAJA4 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DPF3 | Affinity Capture-MS | physical | 26582913, (Europe PMC) | NA | BioGRID |
| DPP9 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| EGFR | Affinity Capture-MS | physical | 23956138, 24797263, (Europe PMC) | NA | BioGRID |
| ERLIN2 | Affinity Capture-MS, tandem affinity purification | association, physical | 21343306, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ESRRB | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| FBXO6 | Affinity Capture-MS | physical | 22268729, (Europe PMC) | NA | BioGRID |
| FUS | Affinity Capture-MS | physical | 25192599, (Europe PMC) | NA | BioGRID |
| GNE | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| HDAC6 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 23752268, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ILK | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 23455922, 25852190, (Europe PMC) | 0.53 | BioGRID, IntAct |
| IRAK1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| JCHAIN | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| KDM1A | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| KEAP1 | Affinity Capture-MS | physical | 27621311, (Europe PMC) | NA | BioGRID |
| MAGED1 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| MCM2 | Affinity Capture-MS | physical | 25963833, (Europe PMC) | NA | BioGRID |
| MTMR11 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| MUC5B | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| NCKAP1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| NDUFA4 | Affinity Capture-MS | physical | 27499296, (Europe PMC) | NA | BioGRID |
| NDUFAF8 | Affinity Capture-MS | physical | 27499296, (Europe PMC) | NA | BioGRID |
| NFATC2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| NME4 | Affinity Capture-MS | physical | 27499296, (Europe PMC) | NA | BioGRID |
| NOS2 | Affinity Capture-MS | physical | 23438482, (Europe PMC) | NA | BioGRID |
| OBSL1 | Affinity Capture-MS | physical | 24711643, (Europe PMC) | NA | BioGRID |
| OCIAD1 | Affinity Capture-MS | physical | 27499296, (Europe PMC) | NA | BioGRID |
| PAFAH1B2 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PAN2 | Affinity Capture-MS | physical | 23398456, (Europe PMC) | NA | BioGRID |
| PELO | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PHB2 | Affinity Capture-MS | physical | 17353931, (Europe PMC) | NA | BioGRID |
| PTPMT1 | Affinity Capture-MS | physical | 27499296, (Europe PMC) | NA | BioGRID |
| RAF1 | Affinity Capture-MS, anti tag coimmunoprecipitation, two hybrid | association, physical, physical association | 12620389, 25852190, (Europe PMC) | 0.55 | BioGRID, IntAct |
| RNF2 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| RPS6KB2 | Affinity Capture-MS | physical | 25324306, (Europe PMC) | NA | BioGRID |
| RYK | Affinity Capture-MS | physical | 21875946, (Europe PMC) | NA | BioGRID |
| SDHA | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SDHB | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SFXN1 | Co-fractionation, proximity-dependent biotin identification | association, physical | 22939629, 29568061, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SFXN3 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SHC1 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| SLC25A6 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SMURF1 | Affinity Capture-MS | physical | 23184937, (Europe PMC) | NA | BioGRID |
| SRSF5 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SUZ12 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| SYNCRIP | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| TCF3 | Affinity Capture-MS | physical | 22354994, (Europe PMC) | NA | BioGRID |
| TIMM13 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| TIMM17B | Affinity Capture-Western, anti bait coimmunoprecipitation | association, physical | 23263864, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TNFRSF10B | Two-hybrid | physical | 15044455, (Europe PMC) | NA | BioGRID |
| TOMM40 | Co-fractionation | physical | 22939629, 26344197, (Europe PMC) | NA | BioGRID |
| TOMM7 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| TOMM70 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| TP53 | Affinity Capture-MS | physical | 23443559, (Europe PMC) | NA | BioGRID |
| TRIM25 | Affinity Capture-RNA | physical | 29117863, (Europe PMC) | NA | BioGRID |
| TRUB2 | Affinity Capture-MS | physical | 27499296, (Europe PMC) | NA | BioGRID |
| TUBA1C | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TUBA3E | Affinity Capture-MS, tandem affinity purification | physical, physical association | 20360068, (Europe PMC) | 0.40 | BioGRID, IntAct |
| TUBG1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| UBC | Affinity Capture-MS | physical | 16196087, (Europe PMC) | NA | BioGRID |
| VAMP2 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| WASF1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| WASF2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| WASF3 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ZKSCAN8 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ZNF100 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ZNF624 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ZNF629 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ZNF724 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ZNF746 | Affinity Capture-MS | physical | 25315684, (Europe PMC) | NA | BioGRID |
| ZNF852 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ZSCAN20 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AKTIP | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| ARAF | Affinity Capture-MS, anti tag coimmunoprecipitation, two hybrid | association, physical, physical association | 12620389, 25852190, (Europe PMC) | 0.55 | BioGRID, IntAct |
| BRAF | two hybrid | physical association | 12620389, (Europe PMC) | 0.37 | IntAct |
| CBX5 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 20562864, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CBX6 | tandem affinity purification | association | 27705803, (Europe PMC) | 0.35 | IntAct |
| CBX7 | tandem affinity purification | association | 27705803, (Europe PMC) | 0.35 | IntAct |
| COX14 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| COX15 | blue native page | association | 23260140, (Europe PMC) | 0.35 | IntAct |
| DNAJA4 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DNM1 | two hybrid pooling approach | physical association | 16169070, (Europe PMC) | 0.37 | IntAct |
| ERBB2 | tandem affinity purification | association | 24189400, (Europe PMC) | 0.35 | IntAct |
| ERLIN2 | Affinity Capture-MS, tandem affinity purification | association, physical | 21343306, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GABARAP | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GABARAPL1 | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| HDAC6 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 23752268, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IKBKB | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| IKBKG | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| ILK | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 23455922, 25852190, (Europe PMC) | 0.53 | BioGRID, IntAct |
| IRAK1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| KSR1 | anti tag coimmunoprecipitation | association | 27086506, (Europe PMC) | 0.35 | IntAct |
| L3MBTL1 | tandem affinity purification | association | 27705803, (Europe PMC) | 0.35 | IntAct |
| MAGED1 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| MAP1LC3A | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| MAP1LC3B | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| MAP3K1 | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| MAP3K14 | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| MAP3K3 | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| NFKB2 | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| NFKBIA | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| NFKBIB | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| NFKBIE | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| PAFAH1B2 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PELO | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PHB2 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| PLEKHA7 | anti bait coimmunoprecipitation | association | 28877994, (Europe PMC) | 0.35 | IntAct |
| PPEF1 | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| PPP1R15A | anti tag coimmunoprecipitation | association | 29109149, (Europe PMC) | 0.35 | IntAct |
| RAF1 | Affinity Capture-MS, anti tag coimmunoprecipitation, two hybrid | association, physical, physical association | 12620389, 25852190, (Europe PMC) | 0.55 | BioGRID, IntAct |
| RELA | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| RELB | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| RIPK1 | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| RIPK3 | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| RIPK4 | anti tag coimmunoprecipitation | association | 26972000, (Europe PMC) | 0.35 | IntAct |
| SFXN1 | Co-fractionation, proximity-dependent biotin identification | association, physical | 22939629, 29568061, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SLA | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| TAB2 | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| TFAP2A | two hybrid | physical association | 24835590, (Europe PMC) | 0.37 | IntAct |
| TIMM17B | Affinity Capture-Western, anti bait coimmunoprecipitation | association, physical | 23263864, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TIMM21 | anti tag coimmunoprecipitation | association | 23260140, (Europe PMC) | 0.35 | IntAct |
| TIMM23 | anti tag coimmunoprecipitation | physical association | 23260140, (Europe PMC) | 0.40 | IntAct |
| TNFRSF1A | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| TNFRSF1B | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| TRAF1 | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| TSC22D1 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| TUBA1A | pull down | association | 27291054, (Europe PMC) | 0.35 | IntAct |
| TUBA1C | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TUBA3E | Affinity Capture-MS, tandem affinity purification | physical, physical association | 20360068, (Europe PMC) | 0.40 | BioGRID, IntAct |
| TUBB3 | pull down | association | 27291054, (Europe PMC) | 0.35 | IntAct |
| TUBG1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAZ | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ABI2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ACAD9 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| ADRB2 | Affinity Capture-MS | physical | 23798571, (Europe PMC) | NA | BioGRID |
| AIFM1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| AKTIP | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| AMFR | Affinity Capture-MS | physical | 21343306, (Europe PMC) | NA | BioGRID |
| ARAF | Affinity Capture-MS, anti tag coimmunoprecipitation, two hybrid | association, physical, physical association | 12620389, 25852190, (Europe PMC) | 0.55 | BioGRID, IntAct |
| BMI1 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| BPIFB1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| BRAF | two hybrid | physical association | 12620389, (Europe PMC) | 0.37 | IntAct |
| BRK1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| C15orf48 | Affinity Capture-MS | physical | 27499296, (Europe PMC) | NA | BioGRID |
| CBX5 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 20562864, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CBX6 | tandem affinity purification | association | 27705803, (Europe PMC) | 0.35 | IntAct |
| CBX7 | tandem affinity purification | association | 27705803, (Europe PMC) | 0.35 | IntAct |
| CCDC8 | Affinity Capture-MS | physical | 24711643, (Europe PMC) | NA | BioGRID |
| CD55 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| CFTR | Affinity Capture-MS | physical | 26618866, (Europe PMC) | NA | BioGRID |
| CHCHD10 | Affinity Capture-MS | physical | 27499296, (Europe PMC) | NA | BioGRID |
| CHCHD2 | Affinity Capture-MS | physical | 27499296, (Europe PMC) | NA | BioGRID |
| CISD3 | Affinity Capture-MS | physical | 27499296, (Europe PMC) | NA | BioGRID |
| COQ8B | Affinity Capture-MS | physical | 27499296, (Europe PMC) | NA | BioGRID |
| COQ9 | Affinity Capture-MS | physical | 27499296, (Europe PMC) | NA | BioGRID |
| COX14 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| COX15 | blue native page | association | 23260140, (Europe PMC) | 0.35 | IntAct |
| CTDSP2 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| CUL1 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CUL3 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CUL7 | Affinity Capture-MS | physical | 24711643, (Europe PMC) | NA | BioGRID |
| CYFIP1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| CYFIP2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| DNAJA4 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DNM1 | two hybrid pooling approach | physical association | 16169070, (Europe PMC) | 0.37 | IntAct |
| DPF3 | Affinity Capture-MS | physical | 26582913, (Europe PMC) | NA | BioGRID |
| DPP9 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| EGFR | Affinity Capture-MS | physical | 23956138, 24797263, (Europe PMC) | NA | BioGRID |
| ERBB2 | tandem affinity purification | association | 24189400, (Europe PMC) | 0.35 | IntAct |
| ERLIN2 | Affinity Capture-MS, tandem affinity purification | association, physical | 21343306, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ESRRB | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| FBXO6 | Affinity Capture-MS | physical | 22268729, (Europe PMC) | NA | BioGRID |
| FUS | Affinity Capture-MS | physical | 25192599, (Europe PMC) | NA | BioGRID |
| GABARAP | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GABARAPL1 | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GNE | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| HDAC6 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 23752268, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IKBKB | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| IKBKG | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| ILK | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 23455922, 25852190, (Europe PMC) | 0.53 | BioGRID, IntAct |
| IRAK1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| JCHAIN | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| KDM1A | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| KEAP1 | Affinity Capture-MS | physical | 27621311, (Europe PMC) | NA | BioGRID |
| KSR1 | anti tag coimmunoprecipitation | association | 27086506, (Europe PMC) | 0.35 | IntAct |
| L3MBTL1 | tandem affinity purification | association | 27705803, (Europe PMC) | 0.35 | IntAct |
| MAGED1 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| MAP1LC3A | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| MAP1LC3B | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| MAP3K1 | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| MAP3K14 | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| MAP3K3 | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| MCM2 | Affinity Capture-MS | physical | 25963833, (Europe PMC) | NA | BioGRID |
| MTMR11 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| MUC5B | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| NCKAP1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| NDUFA4 | Affinity Capture-MS | physical | 27499296, (Europe PMC) | NA | BioGRID |
| NDUFAF8 | Affinity Capture-MS | physical | 27499296, (Europe PMC) | NA | BioGRID |
| NFATC2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| NFKB2 | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| NFKBIA | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| NFKBIB | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| NFKBIE | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| NME4 | Affinity Capture-MS | physical | 27499296, (Europe PMC) | NA | BioGRID |
| NOS2 | Affinity Capture-MS | physical | 23438482, (Europe PMC) | NA | BioGRID |
| OBSL1 | Affinity Capture-MS | physical | 24711643, (Europe PMC) | NA | BioGRID |
| OCIAD1 | Affinity Capture-MS | physical | 27499296, (Europe PMC) | NA | BioGRID |
| PAFAH1B2 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PAN2 | Affinity Capture-MS | physical | 23398456, (Europe PMC) | NA | BioGRID |
| PELO | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PHB2 | Affinity Capture-MS | physical | 17353931, (Europe PMC) | NA | BioGRID |
| PHB2 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| PLEKHA7 | anti bait coimmunoprecipitation | association | 28877994, (Europe PMC) | 0.35 | IntAct |
| PPEF1 | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| PPP1R15A | anti tag coimmunoprecipitation | association | 29109149, (Europe PMC) | 0.35 | IntAct |
| PTPMT1 | Affinity Capture-MS | physical | 27499296, (Europe PMC) | NA | BioGRID |
| RAF1 | Affinity Capture-MS, anti tag coimmunoprecipitation, two hybrid | association, physical, physical association | 12620389, 25852190, (Europe PMC) | 0.55 | BioGRID, IntAct |
| RELA | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| RELB | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| RIPK1 | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| RIPK3 | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| RIPK4 | anti tag coimmunoprecipitation | association | 26972000, (Europe PMC) | 0.35 | IntAct |
| RNF2 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| RPS6KB2 | Affinity Capture-MS | physical | 25324306, (Europe PMC) | NA | BioGRID |
| RYK | Affinity Capture-MS | physical | 21875946, (Europe PMC) | NA | BioGRID |
| SDHA | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SDHB | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SFXN1 | Co-fractionation, proximity-dependent biotin identification | association, physical | 22939629, 29568061, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SFXN3 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SHC1 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| SLA | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| SLC25A6 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SMURF1 | Affinity Capture-MS | physical | 23184937, (Europe PMC) | NA | BioGRID |
| SRSF5 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SUZ12 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| SYNCRIP | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| TAB2 | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| TCF3 | Affinity Capture-MS | physical | 22354994, (Europe PMC) | NA | BioGRID |
| TFAP2A | two hybrid | physical association | 24835590, (Europe PMC) | 0.37 | IntAct |
| TIMM13 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| TIMM17B | Affinity Capture-Western, anti bait coimmunoprecipitation | association, physical | 23263864, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TIMM21 | anti tag coimmunoprecipitation | association | 23260140, (Europe PMC) | 0.35 | IntAct |
| TIMM23 | anti tag coimmunoprecipitation | physical association | 23260140, (Europe PMC) | 0.40 | IntAct |
| TNFRSF10B | Two-hybrid | physical | 15044455, (Europe PMC) | NA | BioGRID |
| TNFRSF1A | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| TNFRSF1B | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| TOMM40 | Co-fractionation | physical | 22939629, 26344197, (Europe PMC) | NA | BioGRID |
| TOMM7 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| TOMM70 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| TP53 | Affinity Capture-MS | physical | 23443559, (Europe PMC) | NA | BioGRID |
| TRAF1 | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| TRIM25 | Affinity Capture-RNA | physical | 29117863, (Europe PMC) | NA | BioGRID |
| TRUB2 | Affinity Capture-MS | physical | 27499296, (Europe PMC) | NA | BioGRID |
| TSC22D1 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| TUBA1A | pull down | association | 27291054, (Europe PMC) | 0.35 | IntAct |
| TUBA1C | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TUBA3E | Affinity Capture-MS, tandem affinity purification | physical, physical association | 20360068, (Europe PMC) | 0.40 | BioGRID, IntAct |
| TUBB3 | pull down | association | 27291054, (Europe PMC) | 0.35 | IntAct |
| TUBG1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| UBC | Affinity Capture-MS | physical | 16196087, (Europe PMC) | NA | BioGRID |
| VAMP2 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| WASF1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| WASF2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| WASF3 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| YWHAZ | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| ZKSCAN8 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ZNF100 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ZNF624 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ZNF629 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ZNF724 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ZNF746 | Affinity Capture-MS | physical | 25315684, (Europe PMC) | NA | BioGRID |
| ZNF852 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ZSCAN20 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| Phosphorylating Kinases | Phosphoresidues | Detection Method | PubMed IDs | Source |
| Unknown | S107_DEFDNDPsLVQQLRR, S112_DPILVQQsRRTYKYF, | in vivo | 20068231,(Europe PMC) | HPRD, |