Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
PXYLP1
Gene Name  | PXYLP1 (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | PXYLP1 , ACPL2, HEL124 | |
| Protein Name | PXYLP1 |
|
| Alternative Name(s) |
2-phosphoxylose phosphatase 1;3.1.3.-;Acid phosphatase-like protein 2;Xylosyl phosphatase;epididymis luminal protein 124; | |
| EntrezGene ID | 92370 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q8TE99 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 55240 Dalton | |
| Protein Length | 480 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000155893 (Ensembl) | | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: histidine phosphatase (HP) | Historic class: Histidine acid phosphatase | CATH ID: 3.40.50.1240 | SCOP Fold: HP | |
| Phosphatase activity | active | Catalytic signature motif: unknown | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Golgi apparatus membrane Note=Colocalizes to Golgi apparatus in aB3GAT3-dependent manner | |||
| Function (UniProt annotation) | |||
| Responsible for the 2-O-dephosphorylation of xylose inthe glycosaminoglycan-protein linkage region of proteoglycansthereby regulating the amount of mature glycosaminoglycan (GAG)chains Sulfated glycosaminoglycans (GAGs), including heparansulfate and chondroitin sulfate, are synthesized on the so-calledcommon GAG-protein linkage region (GlcUAbeta1-3Galbeta1-3Galbeta1-4Xylbeta1-O-Ser) of core proteins, which is formed by the stepwiseaddition of monosaccharide residues by the respective specificglycosyltransferases Xylose 2-O-dephosphorylation duringcompletion of linkage region formation is a prerequisite for theinitiation and efficient elongation of the repeating disaccharideregion of GAG chains | |||
| Catalytic Activity (UniProt annotation) | |||
| NA | |||
| Protein Sequence | |||
| MLFRNRFLLLLALAALLAFVSLSLQFFHLIPVSTPKNGMSSKSRKRIMPDPVTEPPVTDPVYEALLYCNIPSVAERSMEG HAPHHFKLVSVHVFIRHGDRYPLYVIPKTKRPEIDCTLVANRKPYHPKLEAFISHMSKGSGASFESPLNSLPLYPNHPLC EMGELTQTGVVQHLQNGQLLRDIYLKKHKLLPNDWSADQLYLETTGKSRTLQSGLALLYGFLPDFDWKKIYFRHQPSALF CSGSCYCPVRNQYLEKEQRRQYLLRLKNSQLEKTYGEMAKIVDVPTKQLRAANPIDSMLCHFCHNVSFPCTRNGCVDMEH FKVIKTHQIEDERERREKKLYFGYSLLGAHPILNQTIGRMQRATEGRKEELFALYSAHDVTLSPVLSALGLSEARFPRFA ARLIFELWQDREKPSEHSVRILYNGVDVTFHTSFCQDHHKRSPKPMCPLENLVRFVKRDMFVALGGSGTNYYDACHREGF |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000139 | C:Golgi membrane |
| GO:0005794 | C:Golgi apparatus |
| GO:0006024 | P:glycosaminoglycan biosynthetic process |
| GO:0010909 | P:positive regulation of heparan sulfate proteoglycan biosynthetic process |
| GO:0016021 | C:integral component of membrane |
| GO:0016791 | F:phosphatase activity |
| GO:0050650 | P:chondroitin sulfate proteoglycan biosynthetic process |