Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
PTPRN2
Gene Name  | PTPRN2 (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | PTPRN2, KIAA0387 | |
| Protein Name | PTPRN2 |
|
| Alternative Name(s) |
Receptor-type tyrosine-protein phosphatase N2;R-PTP-N2;3.1.3.-;3.1.3.48;Islet cell autoantigen-related protein;IAR;ICAAR;Phogrin;IA-2beta60; | |
| EntrezGene ID | 5799 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q92932 (protein sequence) | |
| Enzyme Class | EC 3.1.3.48 (BRENDA ) | |
| Molecular Weight | 111271 Dalton | |
| Protein Length | 1015 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000155093 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: Class I Cys-based PTPs --> Family: R-PTP | Historic class: Class I Cys-based PTPs --> Classical PTPs --> Receptor-type PTPs (R-PTPs) | CATH ID: 3.90.190.10 | SCOP Fold: CC1 | |
| Phosphatase activity | active | Catalytic signature motif: HCSDGAGR | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasmic vesicle, secretory vesiclemembrane Cytoplasmicvesicle, secretory vesicle, synaptic vesicle membrane Note=Predominantly foundon dense-core secretory granules Sorting to secretory granules inpart is dependent of the N-terminal propeptide domain of theprecursor and its interaction with CPE (By similarity)Transiently found at the cell membrane, when secretory vesiclesfuse with the cell membrane to release their cargo Is thenendocytosed and recycled to secretory vesicles involving clathrin-dependent AP2-mediated endocytosis Recycled via STX6- but notTTTGN1/TGN38-containing compartments (By similarity) IA-2beta60: Cytoplasmic vesicle, secretoryvesicle membrane | |||
| Function (UniProt annotation) | |||
| Plays a role in vesicle-mediated secretory processesRequired for normal accumulation of secretory vesicles inhippocampus, pituitary and pancreatic islets Required for theaccumulation of normal levels of insulin-containing vesicles andpreventing their degradation Plays a role in insulin secretion inresponse to glucose stimuli Required for normal accumulation ofthe neurotransmitters norepinephrine, dopamine and serotonin inthe brain In females, but not in males, required for normalaccumulation and secretion of pituitary hormones, such asluteinizing hormone (LH) and follicle-stimulating hormone (FSH)(By similarity) Required to maintain normal levels of reninexpression and renin release (By similarity) May regulatecatalytic active protein-tyrosine phosphatases such as PTPRAthrough dimerization (By similarity) Has phosphatidylinositolphosphatase activity; the PIPase activity is involved in itsability to regulate insulin secretion Can dephosphorylatephosphatidylinositol 4,5-biphosphate (PI(4,5)P2),phosphatidylinositol 5-phosphate and phosphatidylinositol 3-phosphate (By similarity) Regulates PI(4,5)P2 level in the plasmamembrane and localization of cofilin at the plasma membrane andthus is indirectly involved in regulation of actin dynamicsrelated to cell migration and metastasis; upon hydrolyzation ofPI(4,5)P2 cofilin is released from the plasma membrane and acts inthe cytoplasm in severing F-actin filaments (PubMed:26620550) | |||
| Catalytic Activity (UniProt annotation) | |||
| Protein tyrosine phosphate + H(2)O = proteintyrosine + phosphate | |||
| Protein Sequence | |||
| MGPPLPLLLLLLLLLPPRVLPAAPSSVPRGRQLPGRLGCLLEEGLCGASEACVNDGVFGRCQKVPAMDFYRYEVSPVALQ RLRVALQKLSGTGFTWQDDYTQYVMDQELADLPKTYLRRPEASSPARPSKHSVGSERRYSREGGAALANALRRHLPFLEA LSQAPASDVLARTHTAQDRPPAEGDDRFSESILTYVAHTSALTYPPGSRTQLREDLLPRTLGQLQPDELSPKVDSGVDRH HLMAALSAYAAQRPPAPPGEGSLEPQYLLRAPSRMPRPLLAPAAPQKWPSPLGDSEDPSSTGDGARIHTLLKDLQRQPAE VRGLSGLELDGMAELMAGLMQGVDHGVARGSPGRAALGESGEQADGPKATLRGDSFPDDGVQDDDDRLYQEVHRLSATLG GLLQDHGSRLLPGALPFARPLDMERKKSEHPESSLSSEEETAGVENVKSQTYSKDLLGQQPHSEPGAAAFGELQNQMPGP SKEEQSLPAGAQEALSDGLQLEVQPSEEEARGYIVTDRDPLRPEEGRRLVEDVARLLQVPSSAFADVEVLGPAVTFKVSA NVQNVTTEDVEKATVDNKDKLEETSGLKILQTGVGSKSKLKFLPPQAEQEDSTKFIALTLVSLACILGVLLASGLIYCLR HSSQHRLKEKLSGLGGDPGADATAAYQELCRQRMATRPPDRPEGPHTSRISSVSSQFSDGPIPSPSARSSASSWSEEPVQ SNMDISTGHMILSYMEDHLKNKNRLEKEWEALCAYQAEPNSSFVAQREENVPKNRSLAVLTYDHSRVLLKAENSHSHSDY INASPIMDHDPRNPAYIATQGPLPATVADFWQMVWESGCVVIVMLTPLAENGVRQCYHYWPDEGSNLYHIYEVNLVSEHI WCEDFLVRSFYLKNLQTNETRTVTQFHFLSWYDRGVPSSSRSLLDFRRKVNKCYRGRSCPIIVHCSDGAGRSGTYVLIDM VLNKMAKGAKEIDIAATLEHLRDQRPGMVQTKEQFEFALTAVAEEVNAILKALPQ |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0005001 | F:transmembrane receptor protein tyrosine phosphatase activity |
| GO:0005788 | C:endoplasmic reticulum lumen |
| GO:0005886 | C:plasma membrane |
| GO:0005887 | C:integral component of plasma membrane |
| GO:0006470 | P:protein dephosphorylation |
| GO:0006629 | P:lipid metabolic process |
| GO:0007269 | P:neurotransmitter secretion |
| GO:0030054 | C:cell junction |
| GO:0030285 | C:integral component of synaptic vesicle membrane |
| GO:0030667 | C:secretory granule membrane |
| GO:0030672 | C:synaptic vesicle membrane |
| GO:0034260 | P:negative regulation of GTPase activity |
| GO:0035773 | P:insulin secretion involved in cellular response to glucose stimulus |
| GO:0043195 | C:terminal bouton |
| GO:0043235 | C:receptor complex |
| GO:0043312 | P:neutrophil degranulation |
| GO:0101003 | C:ficolin-1-rich granule membrane |