- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
PPM1H
Gene Name  | PPM1H (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | PPM1H, ARHCL1, KIAA1157, URCC2 | |
| Protein Name | PPM1H |
|
| Alternative Name(s) |
Protein phosphatase 1H;3.1.3.16; | |
| EntrezGene ID | 57460 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q9ULR3 (protein sequence) | |
| Enzyme Class | EC 3.1.3.16 (BRENDA ) | |
| Molecular Weight | 56448 Dalton | |
| Protein Length | 514 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000111110 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: PPM | Historic class: PSTPs --> PP2C | CATH ID: 3.60.40.10 | SCOP Fold: PPM | |
| Phosphatase activity | active | Catalytic signature motif: unknown | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Nucleus Cytoplasm | |||
| Function (UniProt annotation) | |||
| Dephosphorylates CDKN1B at 'Thr-187', thus removing asignal for proteasomal degradation | |||
| Catalytic Activity (UniProt annotation) | |||
| [a protein]-serine/threonine phosphate + H(2)O= [a protein]-serine/threonine + phosphate | |||
| Protein Sequence | |||
| MLTRVKSAVANFMGGIMAGSSGSEHGGGSCGGSDLPLRFPYGRPEFLGLSQDEVECSADHIARPILILKETRRLPWATGY AEVINAGKSTHNEDQASCEVLTVKKKAGAVTSTPNRNSSKRRSSLPNGEGLQLKENSESEGVSCHYWSLFDGHAGSGAAV VASRLLQHHITEQLQDIVDILKNSAVLPPTCLGEEPENTPANSRTLTRAASLRGGVGAPGSPSTPPTRFFTEKKIPHECL VIGALESAFKEMDLQIERERSSYNISGGCTALIVICLLGKLYVANAGDSRAIIIRNGEIIPMSSEFTPETERQRLQYLAF MQPHLLGNEFTHLEFPRRVQRKELGKKMLYRDFNMTGWAYKTIEDEDLKFPLIYGEGKKARVMATIGVTRGLGDHDLKVH DSNIYIKPFLSSAPEVRIYDLSKYDHGSDDVLILATDGLWDVLSNEEVAEAITQFLPNCDPDDPHRYTLAAQDLVMRARG VLKDRGWRISNDRLGSGDDISVYVIPLIHGNKLS |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0004721 | F:phosphoprotein phosphatase activity |
| GO:0004722 | F:protein serine/threonine phosphatase activity |
| GO:0005634 | C:nucleus |
| GO:0005654 | C:nucleoplasm |
| GO:0005737 | C:cytoplasm |
| GO:0098978 | C:glutamatergic synapse |
Download FASTA sequences of PPM1H-substrates in Humans
| Substrate Gene Name | Substrate UniProt_AC | DephosphoSite and sequence (+/-5) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| CDKN1B | P46527 | Thr-187_GSVEQtPKKPG | In vitro and in vivo | 22586611, | Europe PMC |  |
| CSE1L | P55060 | NA | In vitro and in vivo | 18059182, | Europe PMC | |
[Feedback|Contribution]
[ Feedback|Contribution]
[Feedback|Contribution]
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ANKRD34A | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| ARHGAP1 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| BLM | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| CAMSAP2 | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| CBY1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| CDC25B | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| CDC25C | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| CDK16 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| CGN | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| CPD | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| DCLK1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| DENND1A | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| DENND4A | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| DENND4C | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| DEPDC1B | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| EIF4E2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| FAM110A | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| FAM110B | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| FAM53C | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| FAM91A1 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| GAB2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| GIGYF1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| GIGYF2 | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| GOLGA4 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| HDAC4 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| HDAC7 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| HNRNPL | Affinity Capture-RNA | physical | 28611215, (Europe PMC) | NA | BioGRID |
| IGF2R | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| INPP5E | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| ITGB1 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| KCTD3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| KIF13B | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| KIF1C | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| KSR1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| LARP1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| LIMA1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| LMAN1 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| LNPEP | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| LPIN3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| LRFN1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| MAGI1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| MAP3K21 | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| MAPKAP1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| MAST3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| MELK | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| MIOS | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| MOV10 | Affinity Capture-RNA | physical | 22658674, (Europe PMC) | NA | BioGRID |
| NADK | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| NAV1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| NF1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| NXF1 | Affinity Capture-RNA | physical | 22658674, (Europe PMC) | NA | BioGRID |
| OSBPL6 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| PGRMC2 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| PHLDB2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| PLEKHA5 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| PLEKHA7 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| PPM1J | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| PTPN13 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| PTPN14 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| RAB11FIP2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| RALGPS2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| RASAL2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| RPTOR | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| RTKN | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| SCAMP1 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| SH3PXD2A | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| SH3RF3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| SIPA1L1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| SLC12A4 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| SLC6A15 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| SRGAP2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| SRSF12 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| STARD13 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| STX16 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| SYDE1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| TANC2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| TBC1D25 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| TESK2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| TIAM1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| TMF1 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| TPD52 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| TPD52L2 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| TSC1 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| USP21 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| VAMP2 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| VAMP3 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| WDR11 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| YWHAB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 24255178, 27880917, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAE | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| YWHAG | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| YWHAH | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| YWHAQ | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| YWHAZ | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| ZBTB21 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| ZNF638 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ANKRD34A | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| CBY1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| CDC25B | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| CDC25C | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| CDK16 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| CGN | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| DCLK1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| DENND4A | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| DENND4C | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| DEPDC1B | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| EIF4E2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| FAM110A | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| FAM110B | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| GAB2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| GIGYF1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| HDAC4 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| HDAC7 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| INPP5E | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| KCTD3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| KIF13B | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| KIF1C | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| KSR1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| LARP1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| LIMA1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| LPIN3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| LRFN1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| MAGI1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| MAPKAP1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| MAST3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| MELK | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| NADK | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| NAV1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| NF1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| OSBPL6 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| PHLDB2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| PLEKHA5 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| PLEKHA7 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| PTPN13 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| PTPN14 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| RAB11FIP2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| RALGPS2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| RASAL2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| RPTOR | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| SH3PXD2A | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| SH3RF3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| SIPA1L1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| SRGAP2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| SRSF12 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| STARD13 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| SYDE1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| TANC2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| TBC1D25 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| TESK2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| TIAM1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| USP21 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| YWHAB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 24255178, 27880917, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ZBTB21 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| ZNF638 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
[Feedback|Contribution]
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ANKRD34A | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| ARHGAP1 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| BLM | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| CAMSAP2 | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| CBY1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| CDC25B | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| CDC25C | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| CDK16 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| CGN | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| CPD | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| DCLK1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| DENND1A | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| DENND4A | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| DENND4C | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| DEPDC1B | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| EIF4E2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| FAM110A | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| FAM110B | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| FAM53C | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| FAM91A1 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| GAB2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| GIGYF1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| GIGYF2 | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| GOLGA4 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| HDAC4 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| HDAC7 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| HNRNPL | Affinity Capture-RNA | physical | 28611215, (Europe PMC) | NA | BioGRID |
| IGF2R | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| INPP5E | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| ITGB1 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| KCTD3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| KIF13B | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| KIF1C | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| KSR1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| LARP1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| LIMA1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| LMAN1 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| LNPEP | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| LPIN3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| LRFN1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| MAGI1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| MAP3K21 | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| MAPKAP1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| MAST3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| MELK | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| MIOS | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| MOV10 | Affinity Capture-RNA | physical | 22658674, (Europe PMC) | NA | BioGRID |
| NADK | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| NAV1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| NF1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| NXF1 | Affinity Capture-RNA | physical | 22658674, (Europe PMC) | NA | BioGRID |
| OSBPL6 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| PGRMC2 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| PHLDB2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| PLEKHA5 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| PLEKHA7 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| PPM1J | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| PTPN13 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| PTPN14 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| RAB11FIP2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| RALGPS2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| RASAL2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| RPTOR | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| RTKN | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| SCAMP1 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| SH3PXD2A | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| SH3RF3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| SIPA1L1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| SLC12A4 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| SLC6A15 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| SRGAP2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| SRSF12 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| STARD13 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| STX16 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| SYDE1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| TANC2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| TBC1D25 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| TESK2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| TIAM1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| TMF1 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| TPD52 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| TPD52L2 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| TSC1 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| USP21 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| VAMP2 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| VAMP3 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| WDR11 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| YWHAB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 24255178, 27880917, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAE | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| YWHAG | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| YWHAH | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| YWHAQ | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| YWHAZ | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| ZBTB21 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| ZNF638 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, , (Europe PMC) | 0.27 | BioGRID, IntAct |
| Phosphorylating Kinases | Phosphoresidues | Detection Method | PubMed IDs | Source |
| Unknown | S124_NSSKRRSsLPNGEGL, S211_RTLTRAAsLRGGVGA, S221_GGVGAPGsPSTPPTR, S223_VGAPGSPsTPPTRFF, S422_EVRIYDLsKYDHGSD, T113_KAGAVTStPNRNSSK, T224_GAPGSPStPPTRFFT, Y419_SAPEVRIyDLSKYDH, | HTP, in vivo | 18669648, 19651622, 19664995, 20068231,(Europe PMC) | HPRD, PhosphoELM, |