Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
PPM1E
Gene Name  | PPM1E (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | PPM1E, CAMKN, KIAA1072, POPX1 | |
| Protein Name | PPM1E |
|
| Alternative Name(s) |
Protein phosphatase 1E;3.1.3.16;Ca(2+)/calmodulin-dependent protein kinase phosphatase N;CaMKP-N;CaMKP-nucleus;CaMKN;Partner of PIX 1;Partner of PIX-alpha;Partner of PIXA; | |
| EntrezGene ID | 22843 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q8WY54 (protein sequence) | |
| Enzyme Class | EC 3.1.3.16 (BRENDA ) | |
| Molecular Weight | 83952 Dalton | |
| Protein Length | 755 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000175175 (Ensembl) | | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: PPM | Historic class: PSTPs --> PP2C | CATH ID: 3.60.40.10 | SCOP Fold: PPM | |
| Phosphatase activity | active | Catalytic signature motif: unknown | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Nucleus Cytoplasm Note=Atruncated form, major form, with the C-terminal part missing, ismostly found in the cytoplasm and a little in the nucleus Thefull-length, minor form, is found in the nucleus | |||
| Function (UniProt annotation) | |||
| Protein phosphatase that inactivates multifunctional CaMkinases such as CAMK4 and CAMK2 (By similarity) Dephosphorylatesand inactivates PAK May play a role in the inhibition of actinfiber stress breakdown and in morphological changes driven byTNK2/CDC42 Dephosphorylates PRKAA2 (By similarity) | |||
| Catalytic Activity (UniProt annotation) | |||
| [a protein]-serine/threonine phosphate + H(2)O= [a protein]-serine/threonine + phosphate | |||
| Protein Sequence | |||
| MAGCIPEEKTYRRFLELFLGEFRGPCGGGEPEPEPEPEPEPEPESEPEPEPELVEAEAAEASVEEPGEEAATVAATEEGD QEQDPEPEEEAAVEGEEEEEGAATAAAAPGHSAVPPPPPQLPPLPPLPRPLSERITREEVEGESLDLCLQQLYKYNCPSF LAAALARATSDEVLQSDLSAHYIPKETDGTEGTVEIETVKLARSVFSKLHEICCSWVKDFPLRRRPQLYYETSIHAIKNM RRKMEDKHVCIPDFNMLFNLEDQEEQAYFAVFDGHGGVDAAIYASIHLHVNLVRQEMFPHDPAEALCRAFRVTDERFVQK AARESLRCGTTGVVTFIRGNMLHVAWVGDSQVMLVRKGQAVELMKPHKPDREDEKQRIEALGGCVVWFGAWRVNGSLSVS RAIGDAEHKPYICGDADSASTVLDGTEDYLILACDGFYDTVNPDEAVKVVSDHLKENNGDSSMVAHKLVASARDAGSSDN ITVIVVFLRDMNKAVNVSEESDWTENSFQGGQEDGGDDKENHGECKRPWPQHQCSAPADLGYDGRVDSFTDRTSLSPGSQ INVLEDPGYLDLTQIEASKPHSAQFLLPVEMFGPGAPKKANLINELMMEKKSVQSSLPEWSGAGEFPTAFNLGSTGEQIY RMQSLSPVCSGLENEQFKSPGNRVSRLSHLRHHYSKKWHRFRFNPKFYSFLSAQEPSHKIGTSLSSLTGSGKRNRIRSSL PWRQNSWKGYSENMRKLRKTHDIPCPDLPWSYKIE |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0004722 | F:protein serine/threonine phosphatase activity |
| GO:0005634 | C:nucleus |
| GO:0005730 | C:nucleolus |
| GO:0005739 | C:mitochondrion |
| GO:0006469 | P:negative regulation of protein kinase activity |
| GO:0032991 | C:protein-containing complex |
| GO:0035690 | P:cellular response to drug |
| GO:0035970 | P:peptidyl-threonine dephosphorylation |
| GO:0046872 | F:metal ion binding |
| GO:0051496 | P:positive regulation of stress fiber assembly |
