Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
PPEF2
Gene Name  | PPEF2 (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | PPEF2 | |
| Protein Name | PPEF2 |
|
| Alternative Name(s) |
Serine/threonine-protein phosphatase with EF-hands 2;PPEF-2;3.1.3.16; | |
| EntrezGene ID | 5470 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | O14830 (protein sequence) | |
| Enzyme Class | EC 3.1.3.16 (BRENDA ) | |
| Molecular Weight | 86518 Dalton | |
| Protein Length | 753 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000156194 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: PPPL --> Family: PPP | Historic class: PSTPs --> PPP --> PP7 | CATH ID: 3.60.21.10 | SCOP Fold: PPPL | |
| Phosphatase activity | active | Catalytic signature motif: unknown | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm Cell projection,cilium, photoreceptor outer segment Photoreceptor inner segmentNote=Localized to photoreceptors, PPEF-2(L) is at least 2 foldmore abundant in rod inner segments than in the outer segments | |||
| Function (UniProt annotation) | |||
| May play a role in phototransduction Maydephosphorylate photoactivated rhodopsin May function as acalcium sensing regulator of ionic currents, energy production orsynaptic transmission | |||
| Catalytic Activity (UniProt annotation) | |||
| [a protein]-serine/threonine phosphate + H(2)O= [a protein]-serine/threonine + phosphate | |||
| Protein Sequence | |||
| MGSGTSTQHHFAFQNAERAFKAAALIQRWYRRYVARLEMRRRCTWSIFQSIEYAGQQDQVKLHDFFSYLMDHFIPSSHND RDFLTRIFTEDRFAQDSEMKKCSDYESIEVPDSYTGPRLSFPLLPDHATALVEAFRLKQQLHARYVLNLLYETKKHLVQL PNINRVSTCYSEEITVCGDLHGQLDDLIFIFYKNGLPSPERSYVFNGDFVDRGKDSVEILMILFAFMLVYPKEFHLNRGN HEDHMVNLRYGFTKEVMNKYKVHGKEILRTLQDVFCWLPLATLIDEKVLILHGGVSDITDLELLDKIERSKIVSTMRCKT RQKSEKQMEEKRRANQKSSAQGPIPWFLPESRSLPSSPLRLGSYKAQKTSRSSSIPCSGSLDGRELSRQVRSSVELELER CRQQAGLLVTGEKEEPSRSASEADSEAGELRKPTQEEWRQVVDILWSDPMAQEGCKANTIRGGGCYFGPDVTQQLLQKYN MQFLIRSHECKPEGYEFCHNRKVLTIFSASNYYEVGSNRGAYVKLGPALTPHIVQYQANKVTHTLTMRQRISRVEESALR ALREKLFAHSSDLLSEFKKHDADKVGLITLSDWAAAVESVLHLGLPWRMLRPQLVNSSADNMLEYKSWLKNLAKEQLSRE NIQSSLLETLYRNRSNLETIFRIIDSDHSGFISLDEFRQTWKLFSSHMNIDITDDCICDLARSIDFNKDGHIDINEFLEA FRLVEKSCPEGDASECPQATNAKDSGCSSPGAH |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| LIG_CaM_IQ_9 | 20-FKAAALIQRWYRRYVARLE-38 |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0001750 | C:photoreceptor outer segment |
| GO:0001917 | C:photoreceptor inner segment |
| GO:0004722 | F:protein serine/threonine phosphatase activity |
| GO:0005506 | F:iron ion binding |
| GO:0005509 | F:calcium ion binding |
| GO:0005737 | C:cytoplasm |
| GO:0006470 | P:protein dephosphorylation |
| GO:0007601 | P:visual perception |
| GO:0010801 | P:negative regulation of peptidyl-threonine phosphorylation |
| GO:0030145 | F:manganese ion binding |
| GO:0030544 | F:Hsp70 protein binding |
| GO:0031435 | F:mitogen-activated protein kinase kinase kinase binding |
| GO:0043405 | P:regulation of MAP kinase activity |
| GO:0043409 | P:negative regulation of MAPK cascade |
| GO:0043506 | P:regulation of JUN kinase activity |
| GO:0050906 | P:detection of stimulus involved in sensory perception |
| GO:0051879 | F:Hsp90 protein binding |