Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
PMM1
Gene Name  | PMM1 (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | PMM1, PMMH22 | |
| Protein Name | PMM1 |
|
| Alternative Name(s) |
Phosphomannomutase 1;PMM 1;5.4.2.8;PMMH-22; | |
| EntrezGene ID | 5372 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q92871 (protein sequence) | |
| Enzyme Class | EC 5.4.2.8 (BRENDA ) | |
| Molecular Weight | 29747 Dalton | |
| Protein Length | 262 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000100417 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: HAD | Historic class: eukaryotic PMM family | CATH ID: 3.40.50.1000 | SCOP Fold: HAD | |
| Phosphatase activity | deprecated | Catalytic signature motif: unknown | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | DisGeNet | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm | |||
| Function (UniProt annotation) | |||
| Involved in the synthesis of the GDP-mannose anddolichol-phosphate-mannose required for a number of criticalmannosyl transfer reactions In addition, may be responsible forthe degradation of glucose-1,6-bisphosphate in ischemic brain | |||
| Catalytic Activity (UniProt annotation) | |||
| Alpha-D-mannose 1-phosphate = D-mannose 6-phosphate | |||
| Protein Sequence | |||
| MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVVGGSDYCKIAEQLGDGDEVIEKFDYVFAEN GTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNISPIGRSCTLEERIEFSELDKKE KIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYCLDSLDQDSFDTIHFFGNETSPGGNDFEIFADPRTVGHSV VSPQDTVQRCREIFFPETAHEA |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0004615 | F:phosphomannomutase activity |
| GO:0005829 | C:cytosol |
| GO:0006013 | P:mannose metabolic process |
| GO:0006487 | P:protein N-linked glycosylation |
| GO:0009298 | P:GDP-mannose biosynthetic process |
| GO:0043025 | C:neuronal cell body |
| GO:0045047 | P:protein targeting to ER |
| GO:0046872 | F:metal ion binding |
| GO:1990830 | P:cellular response to leukemia inhibitory factor |
