241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update: 11 Mar, 2019
Interactive visualization PLPPR5 structures
(A quick tutorial to explore the interctive visulaization)
Synonyms
PLPPR5 , LPPR5
Protein Name
PLPPR5
Alternative Name(s)
Phospholipid phosphatase-related protein type 5;3.1.3.-;Lipid phosphate phosphatase-related protein type 5;Phosphatidic acid phosphatase type 2d;Plasticity-related gene 5 protein;PRG-5;
Induces filopodia formation and promotes neurite growthin a CDC42-independent manner; impedes neurite growth inhibitory-mediated axonal retraction
Catalytic Activity (UniProt annotation)
NA
Protein Sequence
MPLLPAALTSSMLYFQMVIMAGTVMLAYYFEYTDTFTVNVQGFFCHDSAYRKPYPGPEDSSAVPPVLLYSLAAGVPVLVI
IVGETAVFCLQLATRDFENQEKTILTGDCCYINPLVRRTVRFLGIYTFGLFATDIFVNAGQVVTGNLAPHFLALCKPNYT
ALGCQQYTQFISGEEACTGNPDLIMRARKTFPSKEAALSVYAAMYLTMYITNTIKAKGTRLAKPVLCLGLMCLAFLTGLN
RVAEYRNHWSDVIAGFLVGISIAVFLVVCVVNNFKGRQAENEHIHMDNLAQMPMISIPRVESPLEKVTSVQNHITAFAEV
T
The Lysophospholipid receptor (LPLR) group are members of the G protein-coupled receptor family of integral membrane proteins that are important for lipid signaling. In humans there are eight LPL receptors, each encoded by a separate gene (these genes also sometimes referred to as \Edg\ or endothelial differentiation gene). The ligands for LPLRs are the lysophospholipid extracellular signaling molecules, lysophosphatidic acid (LPA) and sphingosine 1-phosphate (S1P). The primary effects are inhibition of adenylyl cyclase and release of calcium from the endoplasmic reticulum, as well as secondary effects of preventing apoptosis and increasing cell proliferation (Contos JJ et al, 2000; An S et al, 1998; Fukushima N and Chun J, 2001)